KEGG   Candidatus Thiodictyon syntrophicum: THSYN_32160Help
Entry
THSYN_32160       CDS       T05211                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00860  Porphyrin and chlorophyll metabolism
tsy01100  Metabolic pathways
Module
tsy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THSYN_32160
Enzymes [BR:tsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     THSYN_32160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AUB85566
UniProt: A0A2K8UJ21
Position
pTs485:268415..269881
Genome map
AA seq 488 aa AA seqDB search
MNTPTLMVQGTTSDAGKSLLVTAICRWLRRRGVRVAPFKPQNMALNSAVTIDGGEIGRAQ
AVQAAACGLPPHTDMNPVLLKPNSDIGAQVIIQGRAIGNLNAVAYQAYKASARVAVMESY
HRLAGQYQAIVVEGAGSPAEINLRAQDIANMGFAEAVDCPVILIADIDRGGVFAHLVGTL
ALLSPSEQARVQGFVINRFRGDIALLEPGLDWLTEYTGKPVLGVLPYLKGLHLPAEDSLE
RAQGDTLEAALRILVPVLPRLSNHTDLDPLRLHPGVDLRLIGPGEPIPPADLLLLPGSKS
VAADLAWLRAQGWSAAIARHLRYGGKVIGVCGGFQMLGRAIHDPLGLEGPPGSTPGLGLL
DLETTLAADKRLTNVSGRLSLDEAPVTGYEIHAGITTGPGLARPAVLLNDGPDGAISPDG
QVLGTYLHGLFDAPEACAVLLAWAGLDRPQAADYGALREATIERLADMVEAHLDTGALGR
LLGLEKST
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacccaccctgatggtccaaggcaccacctcggacgccggcaagagcctgctg
gtcactgccatctgccgctggctcagacgccgcggggtgcgggtagcgcccttcaagccc
cagaacatggcgctcaacagcgccgtgaccatcgacggcggggagatcggccgcgcccag
gcggtgcaggccgccgcctgcggcctgccgccccacaccgacatgaacccggtgctgctc
aagcccaacagcgacatcggcgcccaggtcatcatccaggggcgcgccatcggcaacctc
aacgccgtcgcctatcaggcgtacaaggccagcgcccgggtcgcggtgatggagtcttac
caccggctggcggggcagtatcaggccatcgtggtcgagggggccggctcccccgccgag
atcaatctgcgcgcccaggacatcgccaacatgggcttcgccgaggccgtcgactgcccg
gtcatcctgatcgcggacatcgaccggggcggcgtcttcgcccacctggtcggcaccctg
gcgctcctctccccgagcgagcaggcgcgcgtccagggcttcgtcatcaatcgcttccgg
ggcgatatcgcactcctggaacccggtctcgactggctcaccgaatacaccggcaagccc
gtcttgggcgtcctgccctatctcaagggtctgcacctgccggccgaggactcgctcgag
cgcgcccagggggacaccctggaagccgccctgcggatcctggtcccggtcctgccgcgc
ctgagcaaccacacggacttagaccccctgcggctgcaccccggggtggacctgcgcctg
atcggaccgggcgagccgatcccgcccgccgacctgctgctcctgcccggctccaagtcg
gtcgccgcggatctggcctggctgcgcgcccagggctggtcggcggccatcgcccgccac
ctgcgctatggcggcaaggtcatcggtgtgtgcggcggcttccagatgctcgggcgcgcc
atccatgatcccctgggcctggagggaccgcccggcagcacgcccgggctggggctcctg
gacctggagaccacgctggcggcggacaaacgcctgaccaacgtcagcggccggctgagc
ctcgacgaggcccccgtcaccggctacgagatccacgcgggcatcaccaccggccccggc
ctggcccgccccgcggtcctgctcaacgacggaccggacggtgccatcagccccgacggc
caggtgctcggcacctacctgcacggactcttcgacgccccggaggcctgcgccgtgctg
ctcgcctgggctggtctggaccggccccaggccgcggactacggggccctgcgcgaggcg
accatcgagcggctggcggatatggtggaggcgcatctggataccggggcgctcggacgc
ctgctggggttggagaagtcgacctga

DBGET integrated database retrieval system