KEGG   Pseudothermotoga thermarum: Theth_0504Help
Entry
Theth_0504        CDS       T01554                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00260  Glycine, serine and threonine metabolism
tta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01130  Biosynthesis of antibiotics
tta01230  Biosynthesis of amino acids
Module
tta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theth_0504
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theth_0504
Enzymes [BR:tta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theth_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH50593
UniProt: F7YX20
Position
504024..505292
Genome map
AA seq 422 aa AA seqDB search
MRIRVDLKCEEIPRCWYNVLADLPFKLDPPLDPKTRKPMPPEALTAIFPPALVEQEISDK
REIPIPEPVLKEYAVYRPTPLYRATYLEEYLQTPARIYYKYEGVSPTGSHKTNTALAQAY
YNKICGTERLVTETGAGQWGSALCYAGAKFGLKVDVFMVRISYEQKPMRKYLMKLYGGDV
VPSPSDRTSFGRSLLEKNGEMPGSLGIAISEAIETVLSDPKAKYSLGSVLNHVLLHQTVI
GLEIKKQLKILGEEPDVILGCHGGGSNFGGTVLPFIPDKLSGKPIKIVACEPTACPSLTK
GRYDYDYGDTAGMTPLLKMYTLGKDFIPPKIHAGGLRYHGAAPIVSKLLHEGLIEAIAFD
QDEAFEAAKTFAKFEGIVPAPESSYAIAGAIREAKKAKEEKVEKVIVFNLSGHGLFDLSA
YV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgagaattagggttgatttgaagtgtgaggagattccaaggtgctggtacaatgttctt
gcagatcttccgttcaaactcgatccaccgctcgatccaaagacaaggaaacctatgcct
ccagaggctttgacagctatcttcccgcctgcgctggtagaacaggaaatctctgacaaa
agggaaatacctattccagaaccagtgctgaaggaatatgcagtttacaggccaactcca
ctttatcgtgcaacctacttagaagagtaccttcaaactcctgcaagaatctattacaag
tacgaaggagtaagtccaactgggagtcacaaaaccaacactgccttagctcaagcttac
tacaacaaaatctgcggtactgaaagacttgttactgaaacaggtgctggtcagtgggga
agtgctttgtgttatgcgggcgcaaaatttggtttgaaagtcgatgttttcatggtcagg
ataagctacgagcaaaagcctatgagaaagtatttgatgaagctttacggtggggatgtt
gttccaagtcccagcgacagaactagctttggaagatctcttttggaaaaaaatggagaa
atgccaggaagcctgggaatagccataagcgaagcaatcgaaactgtattgtctgatcca
aaagcaaagtattctcttggaagtgttttgaaccatgtgcttttgcatcaaacggttatt
ggtcttgagatcaaaaaacagttgaaaatccttggtgaagaaccggacgtaatccttggt
tgtcacggtggaggatcgaacttcggtggaacggttcttcctttcataccagacaaactt
tcgggaaaaccaataaaaatcgttgcttgtgaaccgaccgcttgtccatctttgaccaag
ggaagatacgattacgactatggtgatactgcaggtatgactcctttgcttaagatgtac
acccttggaaaagactttatcccaccgaagatccacgcaggtggactaaggtaccacgga
gcagcaccaattgtttcaaagcttttacacgaaggcttgatcgaagcgatcgcgtttgat
caagatgaggcttttgaagccgcaaagactttcgcaaaatttgagggaatagttccagcc
cctgaaagttcctatgcgatagcaggtgcaataagggaagcaaagaaagcaaaggaagaa
aaagttgaaaaagtcatagtcttcaaccttagtggtcacggattgtttgatctttctgca
tacgtgtga

DBGET integrated database retrieval system