KEGG   Pseudothermotoga thermarum: Theth_0907Help
Entry
Theth_0907        CDS       T01554                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00300  Lysine biosynthesis
tta01100  Metabolic pathways
tta01120  Microbial metabolism in diverse environments
tta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Theth_0907
Enzymes [BR:tta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Theth_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEH50991
UniProt: F7YYG7
Position
885277..886671
Genome map
AA seq 464 aa AA seqDB search
MNEKVDKLVLENKEKLFEAASRLIKIKSVATESAGEGKPFGEGVAKVLEEALKIGEELGF
KTKNVDGYGGHIEFGENGILFGVLGHLDVVPEGEGWSVDPYGGIIKDGYLWGRGAVDNKG
PTVATIFALKAVKDSGIVPKNRVRIILGTDEEAGWNGIKYYFQKEEVPKYAVTPDASFTA
VYAEKGIVNYEITYVRKTSNSNLLYLKGGEASNVVPQKTVAILKNFDENTLEFLRKFRPK
NESRIAWEITNKGLQIEAYGKSAHGSKPEAGVNAIASIVDVLSNLLSSDDDTYLFIKIIS
EKIGYETDGKSLKIAGSDCVTGSLTVNLGLIEMTESELKAVINVRYPIYYSFEMMTNQVV
EALKPLTVKVTGHLKPLFISPDSDLIKLLCEVYTDVTKLPPTLITMGGGTYARAVPCGVA
FGPLLPGRPETEHQPNERILLEDLLLVARIYAQLFYRVLSGELS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaaaagtggacaaattggtgttagaaaataaggaaaaactttttgaggcggct
tcaaggttgatcaaaatcaaatccgttgccacggaatccgcaggggaagggaaacctttt
ggtgaaggggtggcaaaagttcttgaggaagctttgaaaataggagaagagcttggattt
aaaacaaaaaatgtcgatggttacggaggacatatcgaatttggagagaacggtattttg
tttggagtgcttgggcacttagatgttgtgcctgaaggggaaggttggagcgttgatcct
tacggtgggataattaaggatggttacttgtggggaagaggtgcggttgacaacaaaggt
ccgacagttgcaaccatttttgctttgaaggccgttaaagattctgggatagttccaaaa
aacagagtgaggataatacttggcacagatgaggaagccggttggaatgggataaagtat
tattttcaaaaggaagaggttccaaagtacgcagttaccccagatgcttcttttacagct
gtgtatgcagagaaaggaatagtaaattatgagataacctacgtcagaaaaacgtctaat
tccaacttgttgtatctgaaaggcggagaagcttcaaacgttgttccgcaaaaaactgtg
gcaattttgaaaaactttgatgaaaacaccttggaatttctgagaaaatttaggccaaag
aacgaatcgagaatagcgtgggaaatcaccaataaaggcttgcaaatagaagcttatgga
aagtctgcacatggttcaaagccagaagctggtgtaaacgcgattgcctcaattgtggat
gttctttctaatcttttgtcttcggacgacgatacttatctgtttataaagattatttcg
gaaaagataggttatgaaaccgatggaaaatcgctaaaaattgcaggcagcgattgtgtc
acaggtagtttaacggtcaacctgggtttgattgaaatgactgaaagtgaacttaaagcc
gtcataaacgttcgctacccaatatattactccttcgaaatgatgacgaaccaagttgtt
gaagctttaaaacctttaactgtgaaggtaacggggcatttaaaaccgctctttatttca
ccggacagcgatttgataaagcttttgtgcgaagtttataccgatgtgacaaagcttcca
ccaacgttgataacgatgggcgggggaacctacgccagagctgttccctgtggtgttgcc
tttggtcccttgctaccagggcgacctgaaacggagcatcaaccaaatgaaagaatactg
ctggaagatcttttgctagttgcaagaatttacgctcagctgttctacagagtgctttct
ggagaactgagttaa

DBGET integrated database retrieval system