KEGG   Pseudothermotoga thermarum: Theth_1024Help
Entry
Theth_1024        CDS       T01554                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00340  Histidine metabolism
tta01100  Metabolic pathways
tta01110  Biosynthesis of secondary metabolites
tta01230  Biosynthesis of amino acids
Module
tta_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Theth_1024
Enzymes [BR:tta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Theth_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEH51104
UniProt: F7YYR6
Position
1003029..1004330
Genome map
AA seq 433 aa AA seqDB search
MKITTAHDFFHFKTQSLTLNLFLEQEKIVRKIVEDVYINKDEALLRYTRHFDCPDFQYED
FVVKNEEIELAYEWCEKNDPEFLLAVKKAYENIECYHKNQLEKSWFYTTQNGSVLGQLIF
PLKRVGIYVPGGKASYPSTVLMCSIPAKVANVEEIVLVSPPNKQKKLNTYVLATAKICGI
DKIFKIGGAQAIAALAFGTDILPKVDKIVGPGNLYVALAKKIVFGIVDIDSIAGPSEVAI
VADESANPTFIAYDLLAQAEHDPLARTFLITTSKDLATEVSRQVEDILMAEPNEIARESI
ENQGLIILVEKLEQVVDVVEKIAPEHLELLCKGWEDLLVKIKSAGAIFVGEFSPEAIGDY
LAGPNHVLPTQGTARFFSPLGVYDFVKRTSLIKYSKSDFLKNHRHAVKIAYIEGLKFHAR
SLEVREKDVQEGA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataacaacggcacatgattttttccacttcaaaactcaaagcttgacgttgaat
ttgtttttggagcaggaaaaaattgttagaaagattgttgaggatgtttacatcaacaaa
gatgaggcattgttaaggtacacaaggcattttgattgtccagattttcaatacgaagat
ttcgttgtcaaaaacgaagagattgaattagcctatgaatggtgcgagaaaaacgatccc
gaatttttgttggctgttaaaaaggcttatgagaatatagagtgttatcacaaaaaccag
ctagaaaaaagttggttttacacaactcaaaatggatcagttttgggtcagcttattttt
ccattaaaacgtgtgggaatttatgtgcctggtggtaaggcaagttatccttctacagtt
ttaatgtgttcaattccggcaaaagtcgccaatgttgaagaaatcgttttggttagccct
cctaacaagcaaaaaaagttaaacacgtatgtacttgcgaccgcaaaaatttgtggaatt
gacaagattttcaaaataggtggtgcacaggctattgcagcccttgcttttgggacagat
atcttgccgaaggttgataaaatcgttgggcctggtaatttgtacgttgctcttgcaaaa
aagatcgtttttggaattgtcgatatcgattcaatcgcaggtccaagtgaagttgcaata
gttgcagatgaaagcgctaatccaaccttcatagcttatgatcttttggcacaggcagag
cacgatccattggcaagaacttttttgataacaacctcaaaagatctggcgacagaagtt
tcaagacaagttgaagatattctgatggccgaacccaacgagatagctcgcgaatcgatt
gaaaatcaaggattgataatcttggtcgaaaagctggaacaagtagttgatgtggttgaa
aaaatagctccagagcaccttgaattgctttgcaaaggctgggaggatttgctggtaaag
ataaaatcagctggggctatttttgttggagaattttcccccgaagcgatcggtgattat
ttagctggaccgaaccacgttcttccgactcaaggaacggctagattcttctcgccactt
ggtgtttacgattttgtcaaaagaacaagtttgataaaatattcaaaaagtgattttcta
aaaaaccacagacacgctgtcaaaatagcttatatcgagggtttgaaatttcacgcaaga
tctttggaagtgagggaaaaagatgttcaagaaggagcttga

DBGET integrated database retrieval system