KEGG   Pseudothermotoga thermarum: Theth_1826Help
Entry
Theth_1826        CDS       T01554                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00010  Glycolysis / Gluconeogenesis
tta00020  Citrate cycle (TCA cycle)
tta00620  Pyruvate metabolism
tta00640  Propanoate metabolism
tta00650  Butanoate metabolism
tta00680  Methane metabolism
tta01100  Metabolic pathways
tta01120  Microbial metabolism in diverse environments
tta01130  Biosynthesis of antibiotics
tta01200  Carbon metabolism
Module
tta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theth_1826
   00020 Citrate cycle (TCA cycle)
    Theth_1826
   00620 Pyruvate metabolism
    Theth_1826
   00640 Propanoate metabolism
    Theth_1826
   00650 Butanoate metabolism
    Theth_1826
  Energy metabolism
   00680 Methane metabolism
    Theth_1826
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Theth_1826
Enzymes [BR:tta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Theth_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AEH51868
UniProt: F7YW96
Position
1848957..1850132
Genome map
AA seq 391 aa AA seqDB search
MAKKMIQAITGAEAAAYAMKQIEPDVVAAYPITPQTPIVEYYAKFVADGLVKTEMIPVES
EHSAMSAVVGAAAAGARAMTATSAVGLALMHEIVYIAASMRLPVVMHVVNRALSAPLNIH
CDHSDAMAERDSGWIQLYCENAQEVYDLTILAVRLAEHEDVRLPVMVNQDGFIISHGVEP
VELLPDEVVKAFVGELKPLYPLLDTDHPVTYGSLDLYDYYFEHKRQQIEAMKNVLKVFPQ
VAEEFYKISGRKYNFVEPYKMEDAQYVMVALGSTNGTIKYVVDELREKGHKVGLLKIWMF
RPFPKAEIQRWLTGRKAVVVLDRSVSFGAEAPLYEAIKSALYEAASRPLLGSFVYGLGGR
DINPDLIRYAFEKAMKHELVADQEMYLGLRE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaaatgattcaagcaataactggtgcggaagcagctgcttatgcaatgaag
caaatagaacctgatgttgttgcagcttatccgataactcctcaaacacctatcgttgaa
tattacgcaaaattcgttgccgatggtcttgtgaaaactgagatgattcctgttgaaagt
gagcatagtgccatgagtgctgttgttggagcagctgcggctggtgcaagggcgatgact
gccaccagtgctgttggtttggctttgatgcacgaaattgtttacatagctgcttccatg
cggttgccagtcgtcatgcacgttgtcaaccgcgctttgagtgccccgctaaacattcac
tgcgatcacagcgatgctatggcagaaagagattctggatggatacagctttattgtgaa
aatgcgcaagaagtctacgatttgacgattttagccgttagacttgcggagcatgaagac
gttaggcttcccgtgatggtcaaccaggatggatttataatctcgcacggtgttgaacct
gtggaacttttgccagacgaagttgtgaaagccttcgttggtgaattgaaacctttgtat
ccacttcttgacactgatcatcccgtcacctacggttctcttgatctttacgattactac
tttgagcacaaaaggcagcaaatagaagctatgaaaaatgtgcttaaagttttcccacaa
gttgcggaagagttttacaaaatatctggtagaaagtacaactttgttgagccatacaaa
atggaagatgctcagtatgtgatggtggctttgggttcaacgaatggtacgatcaagtat
gtggtcgatgagctcagagaaaaaggacacaaagttgggcttttgaagatatggatgttc
agaccgttcccgaaggcggaaatacaaagatggcttactggaagaaaagcagttgttgtt
cttgataggtcagtttcttttggagctgaagcaccgttgtacgaagcgataaaatctgcg
ctttacgaagctgcttctagacctttgcttggttcattcgtttacggcttgggtggaagg
gatatcaacccagatttgatcagatatgcattcgagaaagccatgaaacacgaactggtt
gcagatcaggaaatgtaccttggcctaagagaatag

DBGET integrated database retrieval system