KEGG   Pseudothermotoga thermarum: Theth_1849Help
Entry
Theth_1849        CDS       T01554                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tta  Pseudothermotoga thermarum
Brite
Enzymes [BR:tta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Theth_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Ubie_methyltran Methyltransf_11 Methyltransf_3 CMAS MTS RrnaAD Methyltransf_32 Fibrillarin Methyltransf_4 Methyltransf_12 DOT1 Methyltr_RsmB-F Methyltransf_23 GidB
Motif
Other DBs
NCBI-ProteinID: AEH51891
UniProt: F7YWB6
Position
complement(1872452..1873444)
Genome map
AA seq 330 aa AA seqDB search
MKDFWKERFIREISSTGNYSDHILKAFLEVPRELFCEYPYDLSEVYTDGVLATARDENEY
TTSSQPSLMALFMESVCLKPEMKVLEIGSGTGYNACVMGKVVGKDGLVVGLEFNKKFCEL
AKRNAEKLGMENVIFLNKDGYEGAKEYTPFDAIVVTVAVDFIPEEWLNQLKEGGRIIAPI
DIYTVESQPAVLFVKRQNEILCQEIVETRFLKAKGKLGNLNNLNLEKLGKLREKPFKEEL
FPLRFSYEFLRILHLCLWSLCEEYGRIYHVEETGYAMIGYKTYIFGEVKKLEKVVENWRM
LEFPLLKEITIVYDKAFEFRQLSARKGGNL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttttggaaagaaaggtttatcagggaaatttcttcaacaggtaattacagt
gatcacatcctaaaagcttttttggaagtacccagagaactgttttgcgagtatccttac
gatttgtcagaagtttacaccgacggcgttcttgccaccgcacgtgatgaaaatgagtac
accacttccagtcaaccttccttaatggcattgttcatggaatcagtttgtttgaaacct
gaaatgaaggtccttgagataggttctggaacaggttacaacgcctgtgtgatgggaaaa
gtcgttggaaaagatggacttgtcgttggtttagaattcaacaaaaaattctgtgaactt
gccaaaagaaacgccgaaaaacttggaatggaaaacgttatctttcttaacaaggatggt
tatgaaggtgccaaggaatacaccccattcgatgcgatagttgttaccgttgctgtggat
ttcatacccgaggaatggttaaaccagcttaaagaaggcggaaggataattgcaccgata
gatatttacactgtggaaagccaacctgctgtgctttttgtgaaaaggcaaaacgaaata
ctgtgtcaagaaatcgtcgaaacaagatttttgaaggcgaaaggaaaacttggaaatctt
aacaacctaaacttagaaaaacttggaaagctcagggaaaaaccgttcaaagaagaattg
tttcccctgcgtttttcttatgaatttttgagaatacttcatctttgcctttggtctttg
tgcgaagaatatggaagaatttaccacgtcgaagaaacaggttatgcgatgatcggttat
aaaacgtacatttttggtgaggtaaaaaaacttgaaaaagttgtcgaaaactggagaatg
ctcgaatttcctttactcaaagagataacaatagtctacgataaagctttcgagtttcgt
cagcttagtgcaagaaaggggggaaatctatga

DBGET integrated database retrieval system