KEGG   Thiohalobacter thiocyanaticus: FOKN1_1000Help
Entry
FOKN1_1000        CDS       T05229                                 

Definition
(GenBank) nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ttc  Thiohalobacter thiocyanaticus
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FOKN1_1000
Enzymes [BR:ttc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     FOKN1_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BAZ93400
UniProt: A0A1Z4VP46
Position
1051891..1052715
Genome map
AA seq 274 aa AA seqDB search
MTQVASIQMASGPNVNANLLEAERMIEEAAKQGAELVVLPENFAIMGVHETDKVEQREAP
GEGPIQEFLFRQARRHKLWLVGGTIPLEASVPDRIRAACLLINPEGEQVARYDKMHLFDV
EVVGSGEKYTESETIEPGNDITVVDTPFGRLGLSVCYDLRFPELYRVMLDRGVEILAVPS
AFTALTGKAHWDVLVRTRAIENLCYVIASAQGGYHLNGRETWGDSMIVDPWGTVLKRLPR
GPGVIMAKLDRGYLESTRRLFPSIEHRRIKCSEV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaagtggcaagtatccagatggcctccgggcccaacgtcaacgccaatctgctc
gaggccgagcgcatgatcgaggaggcggcgaagcagggtgccgaactggtcgtactgccg
gagaacttcgccatcatgggcgtgcacgagaccgacaaggtcgagcagcgcgaggcgccg
ggcgaggggccgatccaggagttcctgttccgtcaggccaggcgccacaagctgtggctg
gtcggcggcaccattccgctcgaggcctcggtcccggacaggatccgcgccgcctgcctg
ctgatcaacccggagggcgagcaggtcgcgcgctacgacaagatgcacctgttcgacgtg
gaggtggtcggcagcggcgagaagtacaccgagtccgaaaccatcgaaccgggcaatgac
atcacggtggtcgacacccccttcggccggctgggcctgtcggtgtgctacgacctgcgc
ttccccgaactctaccgggtgatgctggaccggggcgtggagatcctggccgtgccctcg
gccttcaccgcgctgaccggcaaggcgcactgggatgtgctggtgcgcacccgcgccatc
gagaacctgtgctatgtgatcgcctcggcccagggcggctatcatctgaacgggcgcgag
acctggggcgattccatgatcgtcgatccctggggcacggtgctcaagcgcctgccgcgc
ggccccggcgtgatcatggcgaagcttgaccgcggctatctggagtccacccggcggctg
tttccaagcatcgagcatcgccggatcaagtgcagtgaagtatga

DBGET integrated database retrieval system