KEGG   Thiohalobacter thiocyanaticus: FOKN1_1194Help
Entry
FOKN1_1194        CDS       T05229                                 

Definition
(GenBank) geranylgeranyl pyrophosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00900  Terpenoid backbone biosynthesis
ttc01100  Metabolic pathways
ttc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FOKN1_1194
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ttc01006]
    FOKN1_1194
Enzymes [BR:ttc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     FOKN1_1194
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     FOKN1_1194
Prenyltransferases [BR:ttc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   FOKN1_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: BAZ93593
UniProt: A0A1Z4VQ30
Position
complement(1245256..1246161)
Genome map
AA seq 301 aa AA seqDB search
MKTTDGGFPGFLADCQRRIEAALAARLPGEDIHPQSLHRAMRYATLNGGKRIRPVLVYAA
GQAVGAAPGALDAPACAVEFIHAYSLVHDDLPAMDDDDLRRGNPTCHKVYGEAEAILAGD
ALQALAFHTLAHDPDMAADAAARLRMIEQLALAAGSRGMVGGQSIDLAAVGRELSLLELE
DMHIHKTGALIRVSVLLGALSRPDCPEPQLQALDRYAKCLGLAFQIQDDVLDVEGDTAVL
GKTAGSDQDRNKPTYPALLGLAEAKQRARELIDEAREALDGFGPGAAPLHGLADHLLRRS
H
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgactgacggcggctttccggggttcctggcggactgccagcggcgcatcgag
gccgcactggccgcgcgcctgcccggcgaagacatccacccgcaatccctgcatcgggcg
atgcgctacgccactctcaatggcggcaagcgcatccgcccggtgctggtctatgccgcc
ggtcaggcggtaggcgccgcccccggggcgctcgacgccccggcctgtgcggtggaattc
attcatgcctattccctggtccacgacgacctgccggccatggacgatgacgacctgcgc
cgcggcaatcccacctgccacaaggtctatggcgaggccgaggccatcctggccggggac
gcgctgcaggcgctggccttccacaccctggcccacgaccctgatatggcggccgatgcc
gccgcccgcctgcgcatgatcgagcagctggcgctggccgccggttcgcgcggcatggtg
ggcggccagtccatcgatctggccgcggtgggccgggagctttccctgctggaactggag
gacatgcacatccacaagaccggggccctgatccgggtcagcgtgctgctgggcgcgctc
agccgcccggactgcccggagccgcagctgcaggcgctggaccgctatgccaagtgcctg
gggctggccttccagatccaggacgacgtgctcgacgtcgagggcgataccgccgtgctg
ggcaagaccgccggcagcgaccaggaccgcaacaaacccacctaccccgccctgctgggc
ctggccgaggccaagcagcgggcccgggagttgatcgacgaggcccgggaggcgctggac
gggttcggccccggggctgcgccgctgcacggcctggccgaccacctgctgcgccgcagc
cactga

DBGET integrated database retrieval system