KEGG   Thiohalobacter thiocyanaticus: FOKN1_1534Help
Entry
FOKN1_1534        CDS       T05229                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00564  Glycerophospholipid metabolism
ttc01100  Metabolic pathways
ttc01110  Biosynthesis of secondary metabolites
Module
ttc_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FOKN1_1534
Enzymes [BR:ttc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FOKN1_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: BAZ93929
UniProt: A0A1Z4VQL3
Position
complement(1611410..1612294)
Genome map
AA seq 294 aa AA seqDB search
MARDIDRQAGAWDHLRALPQYLLPHHALSRLMLRLTRVRTPWVKNLIINRMRHHFRIDIR
DAVQPDPYAYPSFNAFFTRALRPDARPLAGDDATLISPVDGTVSQAGRIEVNRLLQAKGR
RFTLETLLGGDIELARTFADGDFATLYLSPRDYHRIHMPLEGRLLRTIYVPGRLFSVAPY
TVRSVPRLFARNERLVCLFDTPAGPLAMILVGALFVACIETVWAGVVTPPHGHRIRTKPA
PDNPPVELARGAEMGRFNMGSTVILLSPPGRIDWTADLRPGRHLRMGEALGQLR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggccagggacatcgaccgtcaggccggcgcctgggaccatctgcgcgccctgccccag
tacctgctgccgcaccacgcgctgtcacggctgatgctacgcctgacccgggtgcgcacg
ccctgggtgaagaacctgatcatcaaccgcatgcggcatcacttccgcatcgacatccgg
gacgcggtccagcccgacccgtacgcctatcccagcttcaacgccttcttcacccgcgcc
ctgcgtcccgacgcccggccgctggcgggcgacgacgccaccctgatctccccggtcgac
ggcaccgtcagccaggccgggcgcatcgaggtcaaccggctgctccaggccaagggccgt
cgcttcaccctggagaccctgctgggcggcgacatcgaactggcccggaccttcgccgat
ggcgacttcgccaccctgtatctgtcaccgcgcgactatcaccgcatccacatgccactc
gaggggcgtctgctgaggacgatctacgtcccgggtcgcctgttcagtgtcgccccctac
acggtgcgcagcgtcccgcgcctgttcgcccgcaacgagcgtctggtgtgcctgttcgac
accccggccggtccgctggccatgatcctggtcggcgccctgttcgtggcctgcatcgag
accgtctgggccggcgtggtcacaccgccgcacggccaccgcatccgtaccaagccggcc
ccggacaacccgccggtggaactggcgcgcggggccgagatgggccgcttcaacatgggc
tcgaccgtcatcctcctgtctcccccgggacggatcgactggaccgccgacctccgcccc
ggccggcacctgcgcatgggcgaggcgctcgggcagttgcggtaa

DBGET integrated database retrieval system