KEGG   Thiohalobacter thiocyanaticus: FOKN1_1649Help
Entry
FOKN1_1649        CDS       T05229                                 

Definition
(GenBank) phosphate/sulphate permeases
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ttc  Thiohalobacter thiocyanaticus
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FOKN1_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: BAZ94037
UniProt: A0A1Z4VQY1
Position
1734160..1735746
Genome map
AA seq 528 aa AA seqDB search
MKANTKVAAIRSPEYFRLTAGLVFMIGVFAFGIWHAGHLPTLSGTGLLLLVASAIVGAYM
AMNIGANDVANNMGPAVGSKAVSMGWAIVIAAVFEALGAIIAGGEVVSTIKGGIIDPSQI
AQVSDFAWLMLAALLGAALWLNLATALGAPVSTTHSIIGAVMGAGVAAGGWGLVNWVTIG
KIVASWVISPLLGGVIAVAILYFIKRSITYRRDMNQAAGRIMPWLVALMAWAFTTFMLIK
GLGAILRLPIGQAVGVGLVVAAVVFALIRTPLRRAAAAGNNDKKAVNQLFTWPLVFAAAL
LSFAHGANDVANAIGPLAAIYETIRTGEVAGKAPAPLWILVLGALGLAAGLALYGSKLIR
TVGKEITELDRMRAFAIALSATLTVILAAQLGMPVSTTHVTIGALFGVGFLREYLKTNYA
KMEKIIHAGHKGSDLAAVEAYMKAFEMAPVAEKRVMLAEMKRRAKANDPDALVFAKKERK
AMKKAYKSELVKRSMVLRIVAAWVITVPATAVLAALLFRITTWWDPGL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcaaataccaaagtcgctgccatacgcagtcctgaatacttccggctgaccgcc
ggtctggtcttcatgatcggcgtgttcgccttcggcatctggcacgccgggcatctgccc
acgctgagcggcaccggcctgctgctgctggtcgcctcggccatcgtcggcgcctacatg
gccatgaacatcggcgccaacgacgtggccaacaacatgggcccggcggtgggttcgaag
gccgtgagcatgggctgggcgattgtgatcgcggctgtgttcgaggccctgggcgcgatc
atcgccggcggcgaggtggtgagtaccatcaagggcggcatcatcgatccgtcccagatc
gcccaggtgtccgatttcgcctggctgatgctggccgcgctgctgggcgcggccctgtgg
ctgaacctggccaccgccctgggcgcgccggtctccaccactcattccatcatcggtgcg
gtcatgggcgccggtgtagcggccggcggctggggcctggtcaactgggtcaccattggc
aagatcgtggccagctgggtgatttcgccgctgctgggcggtgtgatcgccgtggccatc
ctgtatttcatcaagcgcagcatcacctaccggcgtgacatgaatcaggccgcgggacgc
atcatgccctggctggtggccctgatggcctgggccttcacgaccttcatgctgatcaag
ggcctcggcgcgatcctgcgtctgcccatcggccaggccgtgggtgttggcctggtggtg
gccgctgtggtatttgccctgattcgcacgccgctgcgccgggcggccgcggccggcaac
aatgacaagaaggcggtcaaccagctgttcacctggccgctggtgttcgccgccgcgctg
ctgagttttgcccatggggcgaacgacgtagccaacgccatcggcccgctggcggccatc
tacgagaccattcgcaccggcgaggtggcgggcaaggcgccggcgccgctgtggattctg
gtgctgggcgcgcttggcctggcggcggggctggcgctgtacggatccaaactgatccgg
accgtaggcaaggagatcacagaactggaccgcatgcgcgcctttgccatcgcactgtcc
gcaaccctgaccgtgatcctggccgcccaactcggtatgccggtctccactacccatgtc
accatcggtgccctgttcggcgtgggcttcctgcgcgagtacctcaagaccaactacgcc
aagatggagaagatcatccatgccggccacaagggcagtgatctggccgcggtcgaagcc
tatatgaaggccttcgagatggccccggtggccgagaagcgggtgatgctggcggagatg
aagcgccgcgccaaggccaatgatccggacgcactggtctttgccaagaaggaacgcaag
gcgatgaagaaggcctacaagagcgaactggtgaagcgctccatggtgctgcgcatcgtc
gccgcctgggtcatcaccgtccccgccaccgccgtgctggccgcactgctgttccggatc
accacctggtgggatccggggctctag

DBGET integrated database retrieval system