KEGG   Thiohalobacter thiocyanaticus: FOKN1_2130Help
Entry
FOKN1_2130        CDS       T05229                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00520  Amino sugar and nucleotide sugar metabolism
ttc01100  Metabolic pathways
ttc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FOKN1_2130
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FOKN1_2130
Enzymes [BR:ttc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FOKN1_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAZ94510
UniProt: A0A1Z4VSA2
Position
complement(2234485..2235534)
Genome map
AA seq 349 aa AA seqDB search
MSLGPVMLDIEGLRPTAAERELLCRPEVGGVILFSRNYTSPDQLQELIDELHGLRDPRLL
IAVDQEGGRVQRFRDGFTRLPPVAELGRVYDEDRARALALAETTGWLMASELRAMGVDLS
FAPVLDIDRRRSSVIGDRAFHRRPEAVAELAHAYQKGMQSAGMAAVGKHYPGHGGVEADS
HLDLPVDERELADLELEDLLPFERLIHQGLAGIMVAHVLYPRIDADLAGFSAFWLQDYLR
RQLRFQGVIFSDDLGMAAAERAGDMVARARSALNAGCDMILVCNRPREARAVVEALEGYE
NPASQARLIRLHGRRALTPEELRRERRWREAVAAVQGYDSEPLLDMDLE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgggaccggtcatgctggacatcgagggtctgcggcccaccgccgcggagcgc
gaactgctgtgccggcccgaggtcggcggggtgattctgttcagccgcaactacacttcg
cccgaccagctgcaggaactcatcgacgaactgcacggtctgcgtgacccgcggctgctc
atcgccgtggaccaggaaggcgggcgggtgcagcgcttccgcgacggtttcacccggctg
ccgccggtggctgaactgggccgggtctatgacgaggaccgcgcccgtgcccttgcgctg
gccgagaccaccggctggctgatggccagcgaactgcgcgccatgggcgtggacctgagc
ttcgcgccggtgctggacatcgaccgccgccgcagttcggtgatcggcgaccgcgccttc
caccgccgaccggaggcggtggcggaactggcccacgcctaccagaagggcatgcagagc
gcgggcatggcggcggtgggcaagcactacccgggccacggcggggtggaggccgactcc
catctggacctgccggtggacgagcgcgaactggccgatctggaactggaggatctgctg
cccttcgagcgcttgattcatcagggcctggccgggatcatggttgcccatgtgctgtat
ccccggatcgatgccgacctggccggcttctcggctttctggctgcaggattacctgcgc
cggcagttgcgctttcagggggtgatcttcagcgatgatctcggcatggccgccgccgag
cgcgccggcgacatggtggcgcgggcccgcagtgcgctgaatgccggttgcgacatgatc
ctggtctgcaatcgcccgcgggaggcgcgggccgtggtcgaggcgctggagggctacgag
aacccggcctcgcaggcgcggctgatccggctgcacggccgccgggcgctgacaccggag
gaactgcgccgcgagcggcgctggcgcgaggcggtggccgcagtgcagggctatgacagc
gagccgctgttggatatggatctggaataa

DBGET integrated database retrieval system