KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1952
Entry
TTE1952           CDS       T00081                                 
Symbol
PurR8
Name
(GenBank) Transcriptional regulator
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Brite
KEGG Orthology (KO) [BR:tte00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tte03000]
    TTE1952 (PurR8)
Transcription factors [BR:tte03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    TTE1952 (PurR8)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_31 Peripla_BP_6 HTH_38 HTH_7 HTH_23 HTH_Tnp_ISL3 Trp_repressor TetR_N HTH_24 MerR TnsD
Other DBs
NCBI-ProteinID: AAM25131
UniProt: Q8R8P3
Position
complement(1898747..1899742)
AA seq 331 aa
MANIREVAKRAGVSVATVSRVLNNSDLVSEETRERVLKAIKELNYHPNLLGRNLRRLKTK
MVLALMPNVSNPFYARVVKGIEDVAHKNGYNVMLCNTDSDPEREKAYLDLLKNKLADGVI
LMASVMGKDELTLLAKNYPVVQCCEYIEGAGASYVSIDNFSAAYKAVKHLINLGLRRIAL
ITCKNDFISTRQRETGYRKALEDANIEFDENLIKYGDYSFKSGMRAARQLLSLEEKPTAI
FAISDIMAIGAIKALKEEGFKVPEDVAVVGFDDISFASMYDPALTTVSQPKYDLGCIAME
VLLKHIEGELEDPQRIFLEHELVIRESTVKY
NT seq 996 nt   +upstreamnt  +downstreamnt
atggctaatataagagaggttgcaaagagggcaggggtttctgttgccacagtctcaaga
gttttaaataacagcgatttggtgtcagaagaaacacgtgagagggttttgaaagccata
aaagagctaaattaccatcccaatcttcttggcagaaatttaaggcgcttaaaaacgaaa
atggtactggcacttatgccaaacgtgtcgaaccccttttatgcaagagttgtaaaggga
atagaagatgtagctcataaaaatgggtacaatgtaatgctttgcaacacagattcagac
cctgagagggaaaaagcgtatttggaccttttgaaaaataagctggcagatggagtcatc
ctcatggcatcagttatgggaaaagacgagttaactcttctggctaaaaattaccctgta
gttcaatgctgtgaatacatagaaggagcgggtgcatcttacgtctctatagacaatttt
tctgctgcctataaagctgtaaagcaccttataaatttgggcctcaggaggatagcactg
attacctgtaaaaacgactttatttccaccaggcaaagagaaacaggatacagaaaggcc
ctggaggatgcgaatatagaatttgatgaaaatttgataaaatatggagattacagtttt
aaaagcgggatgagagcggccagacagcttttatctttagaagaaaagcctactgccata
tttgcaatttctgacataatggccatcggagctataaaggctttaaaagaagagggattt
aaggttccagaagatgtagcagttgtaggatttgacgatataagctttgcctccatgtac
gacccggcccttaccacggtatctcagcccaaatacgatttgggatgtatcgcgatggaa
gtcctcttaaagcatattgaaggggaactggaagatccgcagagaatttttctggagcac
gagcttgttataagagagtcaacagtcaagtattaa

DBGET integrated database retrieval system