KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE0110Help
Entry
TTE0110           CDS       T00081                                 

Gene name
MetG
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00450  Selenocompound metabolism
tte00970  Aminoacyl-tRNA biosynthesis
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TTE0110 (MetG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTE0110 (MetG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tte01007]
    TTE0110 (MetG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tte03016]
    TTE0110 (MetG)
Enzymes [BR:tte01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TTE0110 (MetG)
Amino acid related enzymes [BR:tte01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TTE0110 (MetG)
Transfer RNA biogenesis [BR:tte03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TTE0110 (MetG)
 Prokaryotic type
   Other AARSs
    TTE0110 (MetG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Acyltransf_C DNA_ligase_ZBD Zn-ribbon_8 DALR_1
Motif
Other DBs
NCBI-ProteinID: AAM23414
UniProt: Q8RDD1
Position
111613..113529
Genome map
AA seq 638 aa AA seqDB search
MKKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRIA
REKGMSPKEYVDGIVEWIKDLWKTMDISYDHFIRTTDAYHEEIVQKIFMKLYEQGDIYKG
EYEGWYCTPCESFWTESQLVDGKCPDCGRPVERVTEEGYFFRLSAYGDKLLKYYEEHPDF
IQPESRRNEMINFIKAGLEDLFVSRSTFDWGIKVPFDPKHVIYVWIDALSNYITALGYMT
ENDEKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKKVFGHGWLILEGGKMSKS
KGNVVDPKELVDRYGVDAIRYFLLREVPFGADGVFSNEALINRINSDLANDLGNLLSRTV
TMIEKYFDGVLPKPSSQEEIDEDLINVAQNLPQKVEEYMDKLQFSNALIEIWKLVSRANK
YIDETMPWVLAKDESKRGRLGTVLYNLAESLRFIGILISPFMPNTPKKMFEQLGITEDLT
TWESLKFGLLKEGTRVKRGEILFPRIDVEKELASLEKKTEEKTKETKEEKIDYITIEDFS
KVQLRVAEILEAEKVEGSDKLIKMKLKVGEEIRQIVGGIGKYYSPEELIGKKIIIVYNLQ
PRKLMGIESQGMLLAATNEGKMALLTVDKDIESGSKIS
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagactttttacatcaccactcctatatattaccccagtgacaagctacatatt
ggccattcttacactactgtggctgctgacgcaatggcaaggttcaaaagattgacaggg
tatgacgtgatgtttttgacaggtacagacgagcacgggcagaaaattcagaggatagcc
agagaaaaaggcatgtctccaaaagaatatgtggacggcattgtggaatggataaaagat
ttatggaaaacaatggatataagttatgaccattttattaggacaactgatgcctatcac
gaagaaatagtgcaaaagatattcatgaagttgtacgagcagggggatatatataaggga
gaatacgagggatggtattgcactccttgcgagtctttctggacagaaagccagcttgtg
gatggaaaatgtcctgactgcggaagacccgttgaaagggttacagaggaagggtatttc
ttcagactttcagcttatggagataagcttttgaagtactatgaggagcatccagatttt
atacagccagagtccaggcgaaatgaaatgataaactttataaaggctggattggaggac
ttatttgtctcaaggagcacttttgactggggaataaaagtgccttttgaccctaagcac
gtcatatacgtttggatagatgctctttctaactatatcactgcattaggatatatgaca
gaaaatgatgagaaatttaaaaagtattggcctgcagatgtgcacctcgttggtaaggaa
attgtgaggttccacacgataatatggcctgctatgctcatggctttaggacttcctctt
cctaaaaaggtgtttgggcatggatggttgattttagaaggaggtaaaatgtcaaaatcc
aaagggaatgtagtggaccccaaggaactagtggacaggtacggagtagatgctataagg
tatttcctcttaagagaagttccctttggtgctgacggcgtattttcaaacgaagcttta
ataaacaggataaattccgatttggcaaatgatttgggcaatcttttaagtagaactgtc
acaatgattgagaaatactttgatggagtgttgcctaaaccttcttctcaagaagaaata
gatgaagacctcataaatgtagcgcaaaatttaccacagaaagtagaagaatacatggac
aagttgcaattctccaacgccttaatagagatatggaaattagtgtcaagagctaataag
tacattgatgagactatgccgtgggtgctagcaaaagatgaatctaaaagaggcagactg
ggtacagttttatacaatctggcagaatctttaaggttcataggaattttgatatctcct
tttatgcccaatactcctaaaaagatgtttgaacaattagggattacggaagatttgact
acatgggaaagcttaaaatttgggcttttgaaggaaggcacaagggtgaagagaggagaa
atcctgttccccagaatagatgttgagaaagaactggcatctcttgaaaagaaaactgaa
gaaaaaacaaaagaaacaaaagaagagaagatagattatatcacgatagaagatttttca
aaagttcaactgagagttgctgaaattttagaagctgagaaagtagaaggttcagacaag
ctcattaaaatgaagcttaaagtcggggaagagataaggcagattgtaggaggaattggc
aaatattacagtccagaagagctaataggcaagaagataataattgtatataatttacag
ccgagaaagctcatggggattgaatcccaggggatgctattggcggccactaatgaaggg
aaaatggcgctgttgacggtagacaaagacatagaaagcggttctaaaataagctga

DBGET integrated database retrieval system