KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE0342Help
Entry
TTE0342           CDS       T00081                                 

Gene name
MtlD
Definition
(GenBank) Mannitol-1-phosphate/altronate dehydrogenases
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00051  Fructose and mannose metabolism
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TTE0342 (MtlD)
Enzymes [BR:tte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     TTE0342 (MtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP 3HCDH_N ApbA Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AAM23634
UniProt: Q8RCS0
Position
363110..364270
Genome map
AA seq 386 aa AA seqDB search
MLKALHFGAGNIGRGFIGYLLNKSGYEVTFVDISKEIVDNINKYKKYNVIILKEPVEKEE
VKEVKALHLEEEDKVLDAFLEADMVTTSVGVSNLSSIGGRLKKYLKARKEKNEKPLDIMA
CENALFATDVLRERVVKEEDDDFITYLNLKVGFPNTAVDRIVPAVKIDKKLPVDVAVEEF
FEWDIEKNKIKGNLQIEGVELVDDLKPYIERKLFLLNGAHATTAYLGYLRGYTYIHQAIK
DDNIRAIVKGMQEEISTALSKKYDVDKESLMAYAEKVIKRFENPYLQDEVTRVGREPLRK
LSSEDRLIAPLKLCSEVGITPNFILYGIAAGLLFDYKEDAQAVKMREYVEQFGIKKAVNV
ITGLEEESDLVEEIEKRYFELKGKLI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggcgcttcactttggagcaggcaatatagggagaggatttattggatattta
cttaataaatccggatatgaagttacctttgtagatatttcgaaagaaattgtggataat
attaataagtacaaaaagtacaatgtcattattttaaaagagcctgtggaaaaagaggaa
gtaaaagaggtcaaggctttgcatctagaggaagaggataaagtgcttgatgctttttta
gaggcggatatggttacaacttctgtaggtgtttcaaacctttcttccattggtggaaga
ttaaagaaatacttaaaggcaagaaaagaaaaaaatgaaaaacctcttgacataatggct
tgcgaaaatgcgctttttgctactgacgttttaagagaaagggtagtaaaagaagaggac
gatgattttattacttacctcaatttaaaagttggttttcccaatacagcagttgatagg
attgttccagcagttaaaattgataaaaaacttcctgtggatgtggcagtagaagagttt
tttgagtgggatattgagaaaaataaaattaaagggaacctccaaatagaaggggtagaa
ttagtagatgatttaaaaccttatatagagaggaaattatttttgctaaatggagcccac
gctacaacagcctatttgggctatttaagaggttatacgtatattcatcaagcgataaaa
gatgacaatataagggctatagtgaaaggaatgcaggaagaaatatctactgctctttct
aaaaaatatgatgtagataaagaatctcttatggcctatgcagaaaaagtgattaagagg
tttgaaaatccatatttacaagatgaggttacaagagttggaagggaacctttgagaaag
ctttcatcagaagatagattaattgcacctttaaagctttgcagtgaagttggaattacg
ccaaactttatcctctatggaattgctgctgggcttttatttgactacaaagaagatgca
caggccgttaaaatgagagaatatgtagaacaatttggcataaaaaaggctgtaaatgtt
attacaggacttgaagaggaaagtgatttagtagaagagatagagaaaaggtactttgag
ctaaaaggaaaattaatataa

DBGET integrated database retrieval system