KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE0549Help
Entry
TTE0549           CDS       T00081                                 

Gene name
PaaJ
Definition
(GenBank) Acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00071  Fatty acid degradation
tte00280  Valine, leucine and isoleucine degradation
tte00310  Lysine degradation
tte00362  Benzoate degradation
tte00380  Tryptophan metabolism
tte00620  Pyruvate metabolism
tte00630  Glyoxylate and dicarboxylate metabolism
tte00640  Propanoate metabolism
tte00650  Butanoate metabolism
tte00900  Terpenoid backbone biosynthesis
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01200  Carbon metabolism
tte01212  Fatty acid metabolism
tte02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTE0549 (PaaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    TTE0549 (PaaJ)
   00640 Propanoate metabolism
    TTE0549 (PaaJ)
   00650 Butanoate metabolism
    TTE0549 (PaaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TTE0549 (PaaJ)
   00072 Synthesis and degradation of ketone bodies
    TTE0549 (PaaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TTE0549 (PaaJ)
   00310 Lysine degradation
    TTE0549 (PaaJ)
   00380 Tryptophan metabolism
    TTE0549 (PaaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TTE0549 (PaaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TTE0549 (PaaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TTE0549 (PaaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tte04147]
    TTE0549 (PaaJ)
Enzymes [BR:tte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TTE0549 (PaaJ)
Exosome [BR:tte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTE0549 (PaaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAM23825
UniProt: Q8RC88
Position
555352..556536
Genome map
AA seq 394 aa AA seqDB search
MREAVIVSAVRTAIGKFGGSLAGIPVVDLGAIVIKEALKRAKVAPEQVDEVFMGIILQAG
LGQNPARQSAVKAGIPVEVPATTINMVCGSGLRTVAMAAQAVMLGDADIVVAGGMESMSR
APYLLRDARWGYRMNMPSGELVDEMVYDGLWDVFNQYHMGITAENIAERYKISRQEQDEF
ALRSQNLAEAAIKAGKFEEEIVPVPIPQKKGDPIEFKVDEHPRFGTTMEDLAKLKPAFKP
DGTVTAGNASGINDGAAAVVVMSRDKAKELGVTPLATIKSYAYAGVDPAVMGLGPIYSTR
KALDKAGLKIEDIDLIEANEAFAAQAIAVARELNFDMEKVNVNGGAIALGHPIGASGARI
LVTLLHEMKRRGSRLGLATLCIGGGMGISMIVEM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagctgtaatcgtgagtgcagtgagaactgcaataggaaagtttggaggaagc
ctggctggaattccagtagtggacttaggagcaattgttataaaagaggcattaaaaaga
gcaaaagtagctccagaacaggtagatgaagtattcatgggcattatattacaggcgggc
ttaggtcaaaatcctgcgaggcagtctgctgtaaaagcgggaattcctgtggaggtacct
gctacaacgataaacatggtatgtggttcaggacttagaactgtggctatggcagctcaa
gctgttatgctaggggatgctgatatagttgtggcgggcggtatggaaagcatgtcaaga
gctccgtatttactgagagatgcccgctggggttacaggatgaacatgccttctggagag
cttgttgatgagatggtctatgacgggctgtgggatgttttcaatcagtaccacatgggc
ataacagcagagaacattgcagaaaggtacaaaatttcaaggcaggaacaggatgaattt
gcgctaagaagtcaaaacttagctgaggctgccataaaagcgggaaaatttgaagaagag
attgttcctgtgcccattcctcagaagaaaggagatccaattgaatttaaggtagatgag
catcctagatttggaactactatggaggacctggcgaaattaaaacctgccttcaagccg
gatggaacagtcacagcaggaaatgcttctggaataaatgatggagcggctgcagtagta
gttatgtcaagagataaggcaaaagagctgggcgtaactcctcttgcgactataaaatct
tatgcctacgctggcgttgacccggctgtaatgggtctaggtccaatttactcaacaaga
aaagctcttgacaaggcaggcttgaagatagaggacattgaccttatagaagccaatgaa
gcttttgcagctcaagcaatagcagtagctagagagcttaactttgatatggagaaagtg
aatgtaaacggaggtgcaatagctctaggtcatccgattggggcaagtggagcgagaatt
ttagtgactcttcttcacgaaatgaaaagaagaggttcccgtttaggtcttgctacactt
tgcataggcggtggcatgggtatatcaatgattgtggagatgtaa

DBGET integrated database retrieval system