KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1179Help
Entry
TTE1179           CDS       T00081                                 

Gene name
RuvA
Definition
(GenBank) Holliday junction resolvasome DNA-binding subunit
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTE1179 (RuvA)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TTE1179 (RuvA)
DNA repair and recombination proteins [BR:tte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TTE1179 (RuvA)
    RecFOR pathway proteins
     TTE1179 (RuvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_3 UBA HHH_8 Transposase_20 DUF2642
Motif
Other DBs
NCBI-ProteinID: AAM24410
UniProt: Q8RAN3
Position
1177702..1178265
Genome map
AA seq 187 aa AA seqDB search
MIEYIRGIIEDIGPDHVIIDLMGIGIKIFVPFSTMKELPPKGNITKLYTYLYVREDGFQI
FGFKRKEELELFEKLLSVSGVGPKGALSILSVVPIESFIKAVNSGDYKILTAAPGIGKKT
AERIILELKDKVPKEVVVPKEDSLLNEALEALLALGYTKSEAIYALSDVNCESVEQAVKE
ALKKLAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtacataaggggaattattgaagacataggaccagatcatgtgataatcgac
cttatgggcataggtataaaaatttttgtgcccttttctactatgaaggagttgcctccc
aaaggaaatataacaaagctttacacatacctttacgtcagggaagatggatttcagatt
tttggctttaagagaaaagaagagctagaactttttgagaaattactttctgtgagcggc
gtaggacctaaaggtgctctttctattctctctgttgtgccaatagaaagctttataaag
gcagtaaacagcggtgattacaaaattttaacagcagctcctggcataggaaagaagaca
gcagagaggatcatattagagctcaaggataaagtgcccaaagaggttgtagtcccgaaa
gaggacagcctgttaaatgaggctttagaggctttgctagcattgggttatactaaaagt
gaggctatttacgctctttctgatgtaaactgtgaaagtgtggaacaggctgtcaaagag
gcgctgaaaaaattggcgaaatag

DBGET integrated database retrieval system