KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1237
Entry
TTE1237           CDS       T00081                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00472  D-Arginine and D-ornithine metabolism
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TTE1237
Enzymes [BR:tte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TTE1237
SSDB
Motif
Pfam: OAM_alpha DUF2067 Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AAM24464
UniProt: Q8RAI1
Position
1238670..1239053
AA seq 127 aa
MRREDDFEVRSKHLQHMTDEELDAYFWELAEKIVDPLIELAYYHTSPSIERSVLLRMGFS
SIEAKEIVNRIEERGLLSKGAGHIVLKVAERAKTDYLTAGRGLANGQYLDVLDEIAREAR
ENEAGER
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagaagggaagacgattttgaagtgagaagtaagcacttgcaacacatgacagatgaa
gaattagatgcctacttttgggagttggcggaaaaaattgtggatcctttgatagagctg
gcttattatcacacttctccttccattgaaaggtctgtgcttctgagaatgggattttcc
agcattgaagctaaggaaattgtcaatagaattgaggaaagagggcttctttcaaaggga
gcagggcatatagtgctcaaggtggcagaaagagcaaaaacagactatctcacagcagga
agaggccttgcaaatggccagtatctagatgtgttggatgagattgcaagggaggcgaga
gagaatgaagctggagaaagataa

DBGET integrated database retrieval system