KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1238
Entry
TTE1238           CDS       T00081                                 

Gene name
Sbm3
Definition
(GenBank) Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding)
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00472  D-Arginine and D-ornithine metabolism
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TTE1238 (Sbm3)
Enzymes [BR:tte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TTE1238 (Sbm3)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding DUF3269
Other DBs
NCBI-ProteinID: AAM24465
UniProt: Q8RAI0
Position
1239034..1241238
AA seq 734 aa
MKLEKDKKIDIEEILKGLDKYVPRRRGWHWREGVGRRKIGDFEYYQVSEPLKNSIPLPAA
KYFGNIDPQPDCVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHFDGLIEGTP
EGVGGVPITRKQVRATRKALDLIEDEVGRPINFHSYVSGIAGPEIAVMFAEEGVNGAHQD
PQYNVLYRNVNMVRSFVDAAVAKKIMADADMLQIDGAHNANATAKYGWKVMPELLVQHAI
NTMYSLKVGMKPENIALSTVPPDAPPAPCIRLDLPYAVALRQLFKNYKIRAQMNTKYIEH
DTREATVTHVLNLLISRLTSADIQSTITPDEGRNVPWHYNNINAINTAKQALIGMDGLNE
MVKLNFDGELGKKVRELKMRAILFMEEILEVGGYFKAVEAGFFVDSGYYPERNGDGIVRT
INGGIGAGTVYKRDKDYMAPVCSHFGYNNLPEGLNKPCDLIDGCTLCKREKIQYIDELDE
TDNVHNRLKETFEYRKGDKIKPEVEWAGDGVISMNLFLPVDERTAEYAAIKYAEKLGLTD
IAVLSKLPMHPAEGTYVEIRGRVQFAIDKNELVIPPEEKILSDEEIEEDIKRKPMKVVAA
TVGNDEHSVGLREILDIKHGGIEKYGIKVVYLGTSVPVEKLVDAAIEENADAILVSTIIT
HDDVHIKNMKKVHDLCVEKGIRDRVILVGGGTQITNDLAKSVGFDAGFGRGTKGNQVASF
LVKRRREMENEKDS
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaagctggagaaagataaaaagattgacatagaagagattttaaaaggccttgacaaa
tatgttcctagaagaagaggatggcactggagggaaggggtaggaaggcgcaaaattgga
gattttgagtattaccaggtctctgagccattgaaaaatagcattccactgcctgctgca
aagtattttggaaatattgacccgcaaccagactgcgtgatcaccactgaaattgcttca
ggaagatttgaagacgacataaggcgaatgagaatggcggcatggcacggtgcagaccac
ataatggtgataaggactttggggcagagccattttgacggattgatagaaggaactcct
gagggagtgggaggagtcccaatcacccgcaaacaagttagagcgacgagaaaagctctt
gatttgattgaggatgaagtaggaagacctataaattttcattcatatgtcagtggaatt
gcagggcctgaaatagctgtaatgtttgcggaagagggagtaaacggcgctcatcaggac
ccacagtataacgttttgtatagaaatgtaaatatggttcgctcttttgtggatgcggca
gttgccaaaaagattatggcagatgctgacatgctccaaattgacggagctcacaacgca
aatgcgactgcaaaatatggatggaaagtaatgccagaacttttggtgcagcacgctata
aataccatgtattctctgaaagtgggaatgaagcctgagaacatagctttatctactgtg
ccgccagatgctccgccagcaccctgtataaggcttgaccttccttacgcggtagccttg
aggcagcttttcaaaaattacaagataagggcgcagatgaataccaaatacattgaacac
gatacaagagaggcgacagttacacatgttttaaaccttttaatatcccgcttgacatct
gctgacatccaaagtacaattactcccgatgagggaagaaacgttccgtggcattacaac
aatataaacgctataaatacggccaaacaggcattgattgggatggatggcctcaatgaa
atggtaaaactcaattttgacggagaattggggaagaaagtaagagagctcaagatgagg
gcaatacttttcatggaagaaatactagaagttggtggatattttaaagcagtggaagca
ggattttttgtagattctggctattatcctgagagaaacggtgatggcattgtaaggact
ataaacggaggaattggagctggcacagtgtataagagagataaggactacatggcccct
gtatgctctcattttgggtacaacaacctgccggaaggccttaacaagccctgtgattta
atagatggatgcactttgtgcaagagagagaagattcagtatatagacgaactggacgaa
actgacaatgtgcacaataggttaaaagagacgtttgaatatagaaaaggagacaagata
aaacctgaagttgaatgggctggagatggcgtaataagcatgaacctctttttgcctgtg
gatgagaggactgcagaatatgctgctattaagtacgctgaaaaattagggcttactgat
atagcagttttaagtaagcttccaatgcaccctgcagagggaacatatgtggaaataagg
ggtcgtgttcagtttgccattgataaaaatgagttagtaattccgcctgaagagaagata
ctatcagatgaggaaatagaagaagacataaagagaaagccaatgaaggttgtagcggca
accgtaggaaatgacgaacactctgtcggtttaagggaaatcctggatataaagcacggg
gggattgagaaatacggcataaaagtggtatacctgggtacgtcagttcctgtagaaaag
cttgtagatgcggcaatagaagaaaacgctgatgccattttggtgagcaccataataact
cacgacgatgtgcacatcaaaaacatgaaaaaagtacacgacctgtgtgtagaaaagggc
ataagagacagagtgatactggtagggggaggaacgcagattacaaacgatttggctaaa
agcgtaggatttgatgccggatttggcaggggcacaaaaggaaatcaggtagcaagcttt
ttagttaaaaggagaagggaaatggaaaatgaaaaggacagttga

DBGET integrated database retrieval system