KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1577Help
Entry
TTE1577           CDS       T00081                                 

Gene name
TrpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00260  Glycine, serine and threonine metabolism
tte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01130  Biosynthesis of antibiotics
tte01230  Biosynthesis of amino acids
Module
tte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTE1577 (TrpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTE1577 (TrpA)
Enzymes [BR:tte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TTE1577 (TrpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB
Motif
Other DBs
NCBI-ProteinID: AAM24781
UniProt: Q8R9N0
Position
complement(1534296..1535084)
Genome map
AA seq 262 aa AA seqDB search
MNRIDRRFDDLKKEGKKALITFITAGDPDIDTTYDIVLALEEAGADIIELGIPYSDPLAD
GPTIQASSQRALAKGIKIKDIMDLVMRIREKSDIPIVYLVYYNSVFKYGIEKFLEDSKNA
GVDGLIIPDLPLEERKEVLDVADKYEIYLIPLVAPTSKERIKGITENGKGFVYCVTLTGV
TGAREEITTDLEEYMRLVSSYTSMPKALGFGISGPEMARKLKSLSDGIVVGSAIVERIAK
GYNRCEMLKEVKEFVLSLREVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagaattgatagaaggtttgatgacctcaaaaaagaaggtaaaaaagcccttata
actttcattactgccggagacccagacattgacacaacttatgatatagttttagccctt
gaagaagcaggagcggatataattgaacttggtataccctattctgaccccttggccgat
gggccgacaatccaagcttcttcccagagagctttggctaagggaataaaaattaaagat
ataatggatttggtaatgagaataagagaaaagagcgacattcctattgtctatcttgtt
tattacaactctgtcttcaaatacggcatagagaagtttttggaggattcgaaaaacgca
ggagttgatggactcattattcccgacctccctttggaggagaggaaagaagtcttggat
gtagctgataagtacgaaatttatttaatacctctggtagctcctacttcaaaggagaga
ataaagggaattactgaaaacggtaagggatttgtatactgcgtgactctgactggagtt
acgggagcgagggaggaaattacaacagaccttgaggaatacatgaggctggtatcttca
tataccagcatgccaaaggctttagggtttggcatatcaggacccgaaatggcaagaaag
cttaaaagtttgagcgatggaattgtggtaggaagcgctattgtagaaagaattgctaag
gggtataatagatgtgaaatgttaaaagaggtaaaggaatttgtgttaagcttaagagaa
gtcttgtga

DBGET integrated database retrieval system