KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2348Help
Entry
TTE2348           CDS       T00081                                 

Definition
(GenBank) O-Glycosyl hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00511  Other glycan degradation
tte00600  Sphingolipid metabolism
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TTE2348
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TTE2348
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TTE2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AAM25489
UniProt: Q8R5Q0
Position
2234814..2236145
Genome map
AA seq 443 aa AA seqDB search
MKITGYVTARDYNIPFSKLEKIEKADTKRPDSFVKIYPDEELEEVIGFGGALTEAAAFNI
LSLPEEKQEKILKAYFDEKEGLGYKLVRIHMNSCDFSLESYSCDDVEGDVELKHFNIERD
KKWVIPLLKKIKRYVPDLKVLVSPWSPPAWMKTNNDMKYGGKLKEEYKKTWAEFFVKFIK
AYQEEGIDIWAVTVQNEPMAVQIWESCIYTAEEERDFVKYYLGPTLLENGLSHIKILIWD
HNKDIIYERVKTILEDKEAAKYVWGVGFHWYAGDHFEQLKKIKEEFPHIKLVFTEGTQEG
GVNLGSWNLGERYAHEIIGDFNNYTIGFFDWNIVLDTMGGPNHVKNYCDAPIIVDTEKKE
IFYQSSYYYIGHFSKFIKPGSKTIKSEILDPRLEILSAKTPEGKIIVVVMNKTEENIDIL
LDIGGDLYNAPSIKKSIETFVIN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaccgggtatgtaactgcaagagattataatattcctttttcaaaacttgaa
aaaatagaaaaagcagatacaaaaaggccagactcttttgtaaaaatataccctgatgaa
gaattagaagaagtaatagggttcggaggcgctttaactgaagctgctgccttcaatata
ctaagccttcctgaggaaaaacaagagaaaatattaaaagcctattttgatgaaaaagaa
ggattaggctacaagctcgtcagaattcatatgaatagctgcgatttttcattagagagc
tacagctgtgatgatgtggaaggagatgtggagttaaagcacttcaacatagaaagagat
aaaaaatgggtaatacctcttttaaagaaaataaaacgctatgtccctgacctaaaagtg
cttgtctccccttggagtcctcccgcatggatgaagacaaataacgatatgaaatacgga
ggaaaattaaaagaagaatacaaaaagacgtgggcagaattttttgttaaatttataaaa
gcctatcaggaagaaggtattgacatatgggctgtcacagttcaaaatgagccaatggct
gtgcaaatatgggaatcctgcatatacaccgctgaagaagaaagagactttgtaaaatac
tatttaggaccaactcttttagaaaacggcctttctcatatcaagattcttatatgggac
cataacaaagacataatatacgaaagagtaaaaactatcttagaagataaagaagctgca
aaatacgtctggggtgtaggctttcactggtacgcaggagaccattttgaacaattaaaa
aagataaaagaagaattccctcacataaaactagtatttacagaaggaacccaagaggga
ggagtaaacttgggttcctggaatcttggtgaaagatatgcccatgaaataataggcgat
tttaacaactacacaatcggcttttttgactggaatatagtattagatacaatgggagga
cctaatcacgtcaaaaactactgcgatgctcctatcattgtggatacagagaaaaaagaa
attttttaccaaagttcctactactatatagggcatttttccaaattcataaagcccggg
tcaaaaacaataaaatctgaaatccttgacccaaggttagaaatcctttcagccaaaact
cctgagggtaaaataattgtggtggtaatgaataaaacggaagaaaatatagatatactt
cttgatataggcggtgacctttataatgcaccctctattaaaaagtctattgaaactttt
gtaattaattaa

DBGET integrated database retrieval system