KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2418Help
Entry
TTE2418           CDS       T00081                                 

Gene name
NagC5
Definition
(GenBank) Transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00052  Galactose metabolism
tte00500  Starch and sucrose metabolism
tte00520  Amino sugar and nucleotide sugar metabolism
tte00521  Streptomycin biosynthesis
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01200  Carbon metabolism
Module
tte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE2418 (NagC5)
   00052 Galactose metabolism
    TTE2418 (NagC5)
   00500 Starch and sucrose metabolism
    TTE2418 (NagC5)
   00520 Amino sugar and nucleotide sugar metabolism
    TTE2418 (NagC5)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTE2418 (NagC5)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TTE2418 (NagC5)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TTE2418 (NagC5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AAM25554
UniProt: Q8R7I9
Position
complement(2310631..2311521)
Genome map
AA seq 296 aa AA seqDB search
MKVIGVDIGGTKILGGLIDERGNLLEETLVYTKAHLGREKILENLFIAIDKLIDKDVKGI
GIGSAGRINFKEGIVEYATDNLPGWTGCNLKQLLEDRYKIPVIADNDVNAAVIGEIWQGA
GRGYKDIVMIAIGTGVGGAIVYNGEVIRGGSWSAGEIGHMILYPKGRQCNCGQRGCLEQY
VSGTAIARTYSEVSKEKKIAGAEEVFLLAEKGDKMALEIVNDFVNSLSIAILSLKNLLDP
EIFIIGGGVIGAKRVWWDKLKKTLENRASITPAQLENKATMVGAAKLIIDYLSKNN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaataggtgttgatataggtggtacaaaaatacttgggggcttgattgacgaa
agaggaaacttattggaagagactttagtgtataccaaagcacatctgggaagagagaaa
attcttgaaaatctctttatcgctatagataaactaattgacaaagatgtgaaagggata
gggataggttctgcaggtaggataaactttaaagaggggattgtagagtatgcgacagat
aatttaccaggttggacaggatgcaatttaaagcagctattggaggataggtataaaatt
ccagtaatagcagataatgatgtaaatgctgcagtaattggggagatatggcaaggagca
ggtcgagggtataaagatatagtgatgatagcgataggtacaggtgttggaggcgctatt
gtttataatggggaggtgataagaggggggagctggagtgctggcgagatcggacacatg
attttataccctaagggtaggcaatgtaactgtggccagagaggttgtctggagcagtac
gtttctgggacagctatagccaggacatacagtgaagtttcaaaggaaaagaagattgca
ggagctgaagaggtatttttactggccgaaaaaggcgataagatggctctagaaattgta
aacgattttgtaaattctctttcaatagcaattttgagtttaaaaaacctcttagatcct
gaaatattcataatagggggaggggtgataggagcaaagagggtatggtgggataaatta
aagaagactctagaaaacagggcaagtataacacccgcacagctagaaaataaagccaca
atggtgggtgctgcgaaattgataattgactatctcagcaaaaataattaa

DBGET integrated database retrieval system