KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2499
Entry
TTE2499           CDS       T00081                                 

Symbol
ProP12
Name
(GenBank) Permeases of the major facilitator superfamily
  KO
K05820  MFS transporter, PPP family, 3-phenylpropionic acid transporter
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Brite
KEGG Orthology (KO) [BR:tte00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tte02000]
    TTE2499 (ProP12)
Transporters [BR:tte02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Phenylproprionate permease (PPP) [TC:2.A.1.27]
    TTE2499 (ProP12)
SSDB
Motif
Pfam: MFS_1_like MFS_1 Nuc_H_symport LacY_symp MFS_3 MFS_2
Other DBs
NCBI-ProteinID: AAM25629
UniProt: Q8R7B7
Position
complement(2388979..2390127)
AA seq 382 aa
MGYSAIIYYYFIIFYAVFFMGGAIYGTFVPVYLDYIGYSKSEIGILMSLGPFVAIIAQPF
WGITSDRARSKNFVLQILFLASIFIMALFPLSRNFYYLVAVITLFTFFQTSTGPISDAIT
LEYLSGTGQSFGPIRMAGTIGYAVMSVIAGWFAQRHIGSIFILNIIVMFIAFMIVYKLPV
VKGHQFGKEKISIWKLFSNRNLVVLMLLNFLIQTTLGFYYTYFPIYFRKIGGSNELLGLA
YFISAMSEIPFLLYADKILKRIGTRWALIGASGVAALRWLIISFIPNAYLVLPFQLLHGL
IFIVLYYSMATYINQEVPKELKASGQTVNNLIGMGISRIVGSLLGGFLSDLYGIKMVFLY
NSVLAFCIALIFGYIFLKKASK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggatattcagctattatctattattatttcataatcttttacgcagtattttttatg
ggtggagctatttatggcacttttgtgccggtttatctggactacataggttatagtaag
agtgaaattggaattttgatgtctttaggtccttttgtcgctataatagctcagccattt
tgggggattacaagcgacagagcgaggtctaaaaattttgtcttgcaaattttattttta
gccagtattttcattatggcgttgttccctttgtcgcgcaacttttactatctggtagcc
gttataacacttttcacattttttcagacttctactggccccataagtgatgccataaca
ttggaatatttaagtgggacaggtcaaagttttggaccaattaggatggcaggcacaatt
ggatatgcagtaatgtcagttatagcaggatggtttgcccaaagacatattgggagtatt
tttattttgaacattatagtgatgttcatagcctttatgattgtctataaacttccggtc
gtaaaaggacatcagtttgggaaagagaaaatttccatatggaaacttttttcaaataga
aatttagtggtgttaatgcttcttaattttttaatccagactactttggggttttattat
acgtattttcccatctactttagaaagataggagggagcaacgaacttctgggattagcc
tattttatttctgcaatgagcgaaataccgtttttgttgtatgctgacaagatacttaaa
cgaataggaacaaggtgggcattaataggagcaagtggagtagcggctttaaggtggctt
attatatcgtttattcctaatgcatatttagttttgccttttcagcttttgcacggattg
atttttatagtattgtactattccatggcaacttatattaatcaagaagtaccaaaagaa
ctaaaagcgtcggggcagactgtgaacaatctaataggtatgggaatttcgagaattgtt
ggaagtttattgggagggtttttaagcgacctttatggaataaaaatggtatttctttat
aattctgtattagctttttgtatagcattaatttttgggtacatctttttaaaaaaagcg
tcaaaataa

DBGET integrated database retrieval system