KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2619Help
Entry
TTE2619           CDS       T00081                                 

Gene name
ThrC2
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00260  Glycine, serine and threonine metabolism
tte00750  Vitamin B6 metabolism
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01230  Biosynthesis of amino acids
Module
tte_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTE2619 (ThrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TTE2619 (ThrC2)
Enzymes [BR:tte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TTE2619 (ThrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AAM25739
UniProt: Q8R710
Position
complement(2511829..2512884)
Genome map
AA seq 351 aa AA seqDB search
MAYEGIIKAYREFLPPIRDENIVTLKEGNTPLIEAFNLQRKYLPGIRVYLKYEGLNPTGS
FKDRGMTVAVSQAKQEGSNAVVCASTGNTSASAAAYAAKAGLKSVVLIPGGKIALGKLAQ
AIAYGAEVIAVDGNFDDALRLVREISQKFPITLVNSINPYRLEGQKTAAFEICDALGEVP
DYVSLPVGNAGNITAYWMGFKEYYRKGKIKKLPKMLGFQAAGAAPIVEGRVIENPETIAT
AIRIGNPASWQKAVAARDESGGIIDKVTDEEILEAYSILAKTEGIFAEPASAASIAGVIK
KYKEGFFKEGDSVVCILTGNGLKDPDTAVKLGGEVKRIQPNLKELEEVLYG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgaaggaattataaaagcttatagagagtttttgcctcctataagagatgaa
aatattgtcacgttaaaagagggcaacacacctttaattgaagcttttaacctccaaaga
aaatatttgccgggtataagggtgtatctaaaatacgaagggctaaatcccacaggttct
tttaaggacagggggatgacggtagcggtatctcaagcaaagcaagaagggtctaatgcc
gtcgtatgcgcctcaacaggcaacacttctgcttctgcagcagcctatgcagcaaaagca
ggccttaaaagtgtggtattaattcctggcggtaaaattgctctggggaaactcgcacag
gcaattgcttatggggcagaggttattgcggtagatggcaattttgatgacgctttaagg
cttgtgagagaaatttcgcagaaattcccgattactttggtaaattctataaacccctat
cgcctggaaggccaaaaaacggcagcttttgaaatatgtgatgctttgggagaagtacca
gactatgtctctcttcctgtgggcaatgcaggaaatataactgcttactggatgggattt
aaagaatactaccggaaggggaagataaaaaagcttcccaaaatgcttggctttcaggcg
gcaggagcggctcctattgtggaaggaagagtaatagaaaatcccgagacgattgccacg
gctataagaattggcaaccctgccagctggcagaaggcagtggctgcaagagatgagtcg
ggggggataattgacaaagttacggatgaggaaatactggaggcttattcaattttggca
aaaacagaggggatttttgcagagccagcctctgcagcctccatagcgggtgtgataaag
aagtacaaagaaggattttttaaagaaggagattctgtggtgtgtatccttacggggaat
ggtttaaaagaccctgatactgctgttaaactagggggagaggtaaagagaatacagcca
aatctaaaggaattggaggaagttttgtatggatag

DBGET integrated database retrieval system