KEGG   Thermogutta terrifontis: THTE_0460Help
Entry
THTE_0460         CDS       T05034                                 

Definition
(GenBank) LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ttf  Thermogutta terrifontis
Brite
KEGG Orthology (KO) [BR:ttf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttf03009]
    THTE_0460
Enzymes [BR:ttf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     THTE_0460
Ribosome biogenesis [BR:ttf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    THTE_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ASV73062
UniProt: A0A286RAS2
Position
431972..433090
Genome map
AA seq 372 aa AA seqDB search
MTTLPPFIFATCQSGVENVLKREAARQYPFLRPAFSRRGFVTFKFADATQPLEGFRFEAV
FARAWGFTLGRVEVGDQAEAARQVWKLIGEIPVRMVHVWPRDSAPPGRSDPDTPWPDEVE
QIRSLISAAAPESVNLVAPDTTPRRGLRGQWVLDCIIVDPDEWWVGIHRLEGPETFYPGG
RFPLCLPEHAVSRAYLKMEEALRWSQFPVPPNARWAELGSAPGGASQALLDRGYEVLGVD
PAEMHPAVLKHPKFTHLRRRTTQAPRRAFRKIRWLAADINAAPNYTLDAVESLVTYPQIN
IRGMILTLKLPEWTLADRIPEYLERIRSWGYNVVRARHLWYNKQEICVAALMRPFKRKPV
VVRQKARRKRPT
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacaactctgccgccctttatttttgcgacgtgtcaatcaggggtcgagaacgttctc
aaacgggaagccgctcggcagtatccctttttacgaccggcattcagccgtcgcggtttc
gtcacgtttaaattcgctgacgccacccaacctctggaggggtttcggttcgaggccgtt
tttgcgcgggcatggggcttcacgctgggacgtgttgaggttggtgatcaggcggaagcg
gcgcggcaggtctggaagctgattggggaaatccccgttcggatggtacatgtttggcca
cgggattcggcaccccccggccgaagcgatccggacaccccctggccggacgaggttgag
cagattcgctcgctcatctccgccgctgctcctgagtccgtcaatcttgtcgcgccggac
acgactcctcgtaggggacttcgcgggcagtgggttctcgactgcatcatcgtggacccc
gacgaatggtgggtggggattcatcgcctggaaggtccggaaaccttctatcccggcgga
agatttccactctgtttgccagagcatgccgtttctcgtgcatatctcaaaatggaagag
gccttgaggtggtcgcagtttcctgtaccgcccaatgcccggtgggcggagctgggcagt
gcacccggcggggccagtcaggcccttctcgatcgcggttatgaggtcctcggtgtggac
ccggccgagatgcacccggctgttctaaaacatcccaaattcacccacctgcgccgtcgg
acgacgcaggcaccacgtcgcgcgttcaggaaaattcgctggctcgccgccgacatcaac
gccgctcctaattacaccctcgatgctgtggaaagtcttgtcacctacccccagatcaat
atccggggcatgattctcacgttaaagttgcccgagtggaccctggcggacagaatcccc
gaatatctggaacgcatccgcagttgggggtacaacgtggttcgggcacgacatctgtgg
tataacaagcaggagatctgcgtcgcggctctgatgcggccgttcaaacgtaagcctgtt
gtcgtgcggcagaaagccaggcgaaaacgacctacctga

DBGET integrated database retrieval system