KEGG   Thermogutta terrifontis: THTE_2076Help
Entry
THTE_2076         CDS       T05034                                 

Definition
(GenBank) hypothetical protein
Organism
ttf  Thermogutta terrifontis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 DUF212
Motif
Other DBs
NCBI-ProteinID: ASV74678
UniProt: A0A286RFE3
Position
complement(2137784..2138467)
Genome map
AA seq 227 aa AA seqDB search
MNRPLSAHSSASATTRSLPTVGIGVFLLAIAPFCFAIDLTVAECARANLFPRWLVKAANL
SEFFAHGFGIIVIAILIATLDPRRIHALYVGCTGLLAGLSGDLMKLVIFRIRPRDFDFAG
NVWTTFHEWLPVLSLHPAKLSGSFPSSHAATAAGLAFALTTLYPDGKTVFALLTGFACLQ
RVFAGAHFPSDVAFGAGLGWCAAWFFTRFVLPVRWWKSTPETCTPSS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcctctctctgcccacagttccgcatctgccacaactcgatctcttccaacc
gtgggaattggggtatttctcctcgcgattgctcctttctgttttgccattgatctaacc
gttgcggagtgtgcccgggccaatctgttccccaggtggttggtcaaagctgccaattta
agtgagtttttcgctcacggctttgggatcatagtgatcgcgatcctgatcgcaacgctc
gatccccggcgaatacacgcactttatgtgggatgtacgggtcttctcgctgggttgtcg
ggtgatctcatgaagcttgtgatattccggatccgtccccgcgacttcgatttcgccggt
aacgtctggaccaccttccacgagtggctcccggttctgagccttcatcctgcaaaactc
agcggttctttcccatcttcacacgctgctacggctgctggtttggcttttgctttgaca
accctctatccagacgggaaaaccgtgttcgccctcttaactggcttcgcttgcctgcag
cgggtttttgcaggggcccacttcccgagcgacgtcgcttttggagccggtctcggttgg
tgtgcagcctggttttttacccggttcgtactcccagttcgatggtggaagtcgacccca
gaaacgtgtacgccgtcgtcctga

DBGET integrated database retrieval system