KEGG   Thermus thermophilus HB27: TT_C0184Help
Entry
TT_C0184          CDS       T00170                                 

Definition
(GenBank) LSU ribosomal protein L35P
Organism
tth  Thermus thermophilus HB27
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L35p NST1
Motif
Other DBs
NCBI-ProteinID: AAS80532
UniProt: Q72L77
Position
165406..165594
Genome map
AA seq 62 aa AA seqDB search
MKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLP
YE
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccacaagggcgccaagaagcgggtcaagatcaccgcttcgggcaaggtcgtg
gccatgaagacggggaagcggcacctcaactggcagaagtccgggaaggagatccgccag
aaggggcggaagttcgtcctggccaagccggaggcggagcggatcaagctcctcctcccc
tacgagtga

DBGET integrated database retrieval system