KEGG   Thermus thermophilus HB27: TT_C0249Help
Entry
TT_C0249          CDS       T00170                                 

Definition
(GenBank) trigger factor, ppiase
  KO
K03545  trigger factor
Organism
tth  Thermus thermophilus HB27
Brite
KEGG Orthology (KO) [BR:tth00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    TT_C0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_N Trigger_C SurA_N CIDE-N
Motif
Other DBs
NCBI-ProteinID: AAS80597
UniProt: Q72L16
Position
236992..238206
Genome map
AA seq 404 aa AA seqDB search
MAEILERSGYLVKVRVEVPADRVKASYEALLKDLASRVRVPGFRPGKAPLKVVEARLGRE
ALLQDLKERLVEETYPEAVRELGLSPVAARVVEQDLSEGEGFRYVAEVENYPEVRLPDWR
SFALEVSPPEVTEEMVEKALEELRQRYAELVPVEREAQEKDHLFVRTEEGAEFPIDLAKA
LPHVREALLGKKAGDVVMVPVLNDKGEKVREVRTEVLEVKTLKLPELDEEFAKTLEAESL
EDLKNRVRESLKRQAERAYEEARERAFLEKLAEGLEVEIPPSMLRAEERHLLEHLAEDLY
RQGISLEAYLEALKVKGELEKFQEDLRKEAEKRVRIALAREKLAEELNPEVSEEEWQAYL
QAAARAYGVSVQDLRRQFGEEGLARLKERLRQDKAVQEALKVLG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagatcctggagcgttccggctatctggtcaaggtgcgggtggaggtgcccgcc
gaccgggtgaaggcgagctacgaggccctgcttaaggacctcgcctcccgggtgcgggtg
cccggcttccggccgggcaaggcccccctgaaggtggtggaggcccgcctgggccgggag
gcgctcctccaagaccttaaggagcgcctggtggaggagacctaccccgaggcggtgcgg
gagctcggcctaagccccgtggccgcccgcgtggtggagcaggacctgagcgagggggag
ggcttccgctacgtggccgaggtggagaactaccccgaggtgaggcttcccgactggcgg
agcttcgccttggaggtctccccgcccgaggtcaccgaggagatggtggagaaggccctg
gaggagctccgccagcgctacgccgagctcgtccccgtggagcgggaggcccaggaaaag
gaccacctcttcgtccgcaccgaggagggggcggagttccccattgacctcgctaaagcc
cttccccacgtgcgggaggccctcctcggcaagaaggcgggggacgtggtcatggtcccc
gtgctgaacgacaagggcgagaaggtgcgggaggtcaggaccgaggtcctcgaggtcaag
accctgaagctccccgagctggacgaggagttcgccaagaccctggaggcggaaagcctc
gaggacctcaaaaaccgggtgcgggaaagcctcaagcgccaggcggagcgggcctacgag
gaggccagggagcgggccttcttggagaagctcgccgagggcctggaggtggagatcccc
ccttccatgctccgggcggaggagcgccacctcctggagcacctggccgaggacctctac
cggcaggggatcagcctggaggcctacctcgaggccctgaaggtgaagggggagctggag
aagttccaggaggacctgcgcaaggaggcggagaagcgggtccgcatcgccctcgcccgg
gagaagctcgccgaggaactcaaccccgaggtctccgaggaggagtggcaggcctacctt
caggccgcggcccgggcctacggcgtttccgtccaggaccttcgccgccagttcggcgag
gagggcctcgcccggcttaaggagcgcctccgccaggacaaggcggtgcaggaggccctg
aaggtcctgggctga

DBGET integrated database retrieval system