KEGG   Thermus thermophilus HB27: TT_C0397Help
Entry
TT_C0397          CDS       T00170                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00260  Glycine, serine and threonine metabolism
tth01100  Metabolic pathways
tth01110  Biosynthesis of secondary metabolites
tth01120  Microbial metabolism in diverse environments
tth01130  Biosynthesis of antibiotics
tth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TT_C0397
Enzymes [BR:tth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TT_C0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AAS80745
UniProt: Q72KW7
Position
complement(385232..386254)
Genome map
AA seq 340 aa AA seqDB search
MRLVDLRSDTLTRPTPAMRKAMAEAEVGDDVYGEDPTVNRLEALAAERLGFERALFLPSG
TMANQVALLLHLPRGGEVLAPEGAHLYEYELGAPALLAGALVRPVPAPGGRPDLKALEEA
LRRGPFQAPIGLLALENTHNLAGGRVVPLEVQRRVQDLARARGLPTHLDGARLHNAAVFL
GVEAREVARGFTTAMVSLSKGLGAPVGSLLLLPKELEAEARRYRKLLGGGWRQAGVLAAA
GILALEEGPKHLRRDHEMARALAEGLFRLGLAVDLGAVETNMVYLEVEDPEGFLQGLRAR
GVLAGRVGGRVRFVTHRDLMDEDIPLTLERVQDLLHSRPR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtggacctgaggagcgacaccctcacccgccccaccccggccatgcgcaag
gccatggcggaggcggaggtgggggacgacgtctacggcgaagaccccacggtgaaccgc
ctcgaggccctggcggcggaaaggctcgggtttgaacgggccctcttcctgccctcgggc
accatggccaaccaggtggccctcctcctccacctgccccggggcggcgaggtcctggcc
cccgagggggcccacctctacgagtacgagctcggcgccccggccctcctcgccggggcc
ctggtccgccccgtgcccgccccaggggggaggccggacctgaaggccctggaggaggcc
ctaaggcggggccccttccaggcccccatcgggctactcgccctggagaacacccacaac
ctggccggggggcgggtggtgcccctggaggtccaaaggcgggtccaagacctggcccgc
gcccggggcctccccacccacctggacggggcccgcctccacaacgccgccgtcttcttg
ggggtggaggcccgggaggtggcccggggcttcaccaccgccatggtctccctctccaag
gggctcggggccccggtgggaagcctcctcctcctgcccaaggagctggaggccgaggcc
cggcgttaccgcaagctcctcgggggcgggtggcggcaggcgggggtcttggccgcggcg
gggatcctggccctagaggaaggccccaagcacctccggcgcgaccacgagatggcccgc
gccctggcggaggggctttttcgcctggggctcgccgtggacctgggggcggtggagacc
aacatggtctacctggaggtggaggaccccgagggctttctccagggtctaagggcccgg
ggggtgctcgcggggcgcgtggggggaagggtgcggttcgtgacccaccgggacctcatg
gacgaggacatcccccttaccctggagagggtccaagacctccttcactccaggcccagg
tag

DBGET integrated database retrieval system