KEGG   Thermus thermophilus HB27: TT_C1031Help
Entry
TT_C1031          CDS       T00170                                 

Definition
(GenBank) SSU ribosomal protein S20P
  KO
K02968  small subunit ribosomal protein S20
Organism
tth  Thermus thermophilus HB27
Pathway
tth03010  Ribosome
Module
tth_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TT_C1031
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tth03011]
    TT_C1031
Ribosome [BR:tth03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    TT_C1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p LUC7 MIT DUF3856 DUF2150 AROS
Motif
Other DBs
NCBI-ProteinID: AAS81373
UniProt: P62661
Structure
PDB: 

Position
complement(1008089..1008409)
Genome map
AA seq 106 aa AA seqDB search
MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAE
SLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaagaagcccaagaggaacctttccgcccttaagcggcaccggcagtccctg
aagcgccggctccgcaacaaggccaagaagtcggccatcaagaccctcagcaagaaggcc
gtccagctggcccaggagggcaaggcggaagaggccctgaagatcatgcgcaaggccgaa
agcctcattgacaaggcggcgaagggctccaccctgcacaagaacgccgccgcccgcagg
aagtcccggctgatgcgcaaggtccgtcagctgctcgaggccgcgggggcgcccctcatt
ggcggcggcctcagcgcctaa

DBGET integrated database retrieval system