KEGG   Thermus thermophilus HB27: TT_C1310Help
Entry
TT_C1310          CDS       T00170                                 

Definition
(GenBank) LSU ribosomal protein L30P
  KO
K02907  large subunit ribosomal protein L30
Organism
tth  Thermus thermophilus HB27
Pathway
tth03010  Ribosome
Module
tth_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TT_C1310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tth03011]
    TT_C1310
Ribosome [BR:tth03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    TT_C1310
  Bacteria
    TT_C1310
  Archaea
    TT_C1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L30
Motif
Other DBs
NCBI-ProteinID: AAS81652
UniProt: Q72I22
Structure
PDB: 

Position
complement(1258453..1258635)
Genome map
AA seq 60 aa AA seqDB search
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggctcaaggttaagctggtgaagagccccatcggctaccccaaggaccagaag
gcggccctcaaggccctggggcttaggcggcttcagcaggagcgggtcctcgaggacacc
cccgccatccgggggaacgtggagaaggtggcgcacctcgtgcgcgtggaggtggtggaa
tga

DBGET integrated database retrieval system