KEGG   Thermus thermophilus HB27: TT_C1313Help
Entry
TT_C1313          CDS       T00170                                 

Definition
(GenBank) LSU ribosomal protein L6P
  KO
K02933  large subunit ribosomal protein L6
Organism
tth  Thermus thermophilus HB27
Pathway
tth03010  Ribosome
Module
tth_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TT_C1313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tth03011]
    TT_C1313
Ribosome [BR:tth03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    TT_C1313
  Bacteria
    TT_C1313
  Archaea
    TT_C1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L6
Motif
Other DBs
NCBI-ProteinID: AAS81655
UniProt: Q72I19
Position
complement(1259467..1260009)
Genome map
AA seq 180 aa AA seqDB search
MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERR
HKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEG
ITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggatcggaaggctacccattcccgtacccaagggcgtgagcgtggaggtggcc
cccgggcgggtcaaggtcaagggccccaagggggagctggaggttccggtaagccccgag
atgcgggtggtggtggaggagggcgtggtccgggtggagcggccctccgacgagcgccgc
cacaagagcctccacggcctgacccggaccctcatcgccaacgcggtcaagggcgtttcc
gaggggtacagcaaggagctcctcatcaagggcatcggctaccgggcccggctcgtgggg
cgggccctcgagctcaccgtgggcttcagccaccccgtggtggtggagcccccggagggc
atcacctttgaggtgcccgagcctacccgggtccgggtctcggggatcgacaagcagaag
gtggggcaggtggccgccaacatccgggccatcaggaagcccagcgcctaccacgagaag
gggatctactacgcgggcgagccggtccgcctcaagccgggtaaggccggggccaagaag
tag

DBGET integrated database retrieval system