KEGG   Thermus thermophilus HB27: TT_C1317Help
Entry
TT_C1317          CDS       T00170                                 

Definition
(GenBank) LSU ribosomal protein L24P
  KO
K02895  large subunit ribosomal protein L24
Organism
tth  Thermus thermophilus HB27
Pathway
tth03010  Ribosome
Module
tth_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TT_C1317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tth03011]
    TT_C1317
Ribosome [BR:tth03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    TT_C1317
  Bacteria
    TT_C1317
  Archaea
    TT_C1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ribosomal_L24 KOW zf-NADH-PPase DUF2256 DUF2387 zf-TFIIB zf-ribbon_3 zinc_ribbon_5 Vps36-NZF-N Nudix_N_2 DZR Zn-ribbon_8 DUF3912 TF_Zn_Ribbon Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: AAS81659
UniProt: Q72I15
Position
complement(1261241..1261573)
Genome map
AA seq 110 aa AA seqDB search
MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGF
IEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaagatgcacgtgaagaagggggacacggttctcgtggcctccggcaagtac
aagggccgggtgggcaaggtgaaggaggtcttgcccaagaagtacgccgtcatcgtggag
ggggtcaacatcgtgaagaaggcggtgcgggtgagccctaagtacccccagggcggcttc
attgagaaggaggcccccctgcacgcctccaaggtccgccccatctgccccgcttgcggc
aagcccacccgggtgcggaagaagttcctggagaacggcaagaagatccgggtctgcgcc
aagtgcggcggggccctggacacggaggagtga

DBGET integrated database retrieval system