KEGG   Thermus thermophilus HB27: TT_C1740Help
Entry
TT_C1740          CDS       T00170                                 

Definition
(GenBank) SSU ribosomal protein S6P
  KO
K02990  small subunit ribosomal protein S6
Organism
tth  Thermus thermophilus HB27
Pathway
tth03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TT_C1740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tth03011]
    TT_C1740
   03029 Mitochondrial biogenesis [BR:tth03029]
    TT_C1740
Ribosome [BR:tth03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    TT_C1740
  Bacteria
    TT_C1740
Mitochondrial biogenesis [BR:tth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TT_C1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6 DAO_C
Motif
Other DBs
NCBI-ProteinID: AAS82082
UniProt: P62666
Structure
PDB: 

Position
1653512..1653817
Genome map
AA seq 101 aa AA seqDB search
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYF
LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggtacgaggtgaacatcgtcctgaaccccaacctggaccagagccagctcgcc
ctggagaaggagatcatccagcgggctctggagaactacggcgcccgcgtggagaaggtg
gaggagctggggcttcgccgcctggcctaccccatcgccaaggacccccagggctacttc
ctctggtaccaggtggagatgcccgaggaccgggtgaacgacctggcccgggagctccgc
atccgggacaacgtgcgccgggtcatggtggtgaagtcccaggagcccttcctcgccaac
gcgtaa

DBGET integrated database retrieval system