KEGG   Thioalkalivibrio paradoxus: THITH_06270Help
Entry
THITH_06270       CDS       T03590                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
tti  Thioalkalivibrio paradoxus
Brite
KEGG Orthology (KO) [BR:tti00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    THITH_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHE97924
UniProt: W0DH12
Position
complement(1304996..1305376)
Genome map
AA seq 126 aa AA seqDB search
MSPTEHRVEIEVATAYIEEQSDPEASRFVFAYHITIRNAGEAAVQLLNRHWIIRDARDQT
QEVRGEGVVGKQPRIPPGEEFEYTSGTVLETPVGTMEGSYQMRDDSGFTFEAPIPPFTLS
VPHSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagccctacggaacaccgcgtcgagatcgaagtcgccaccgcgtacatcgaggaacag
tcggatcccgaggcctcgcggttcgtgttcgcctaccacatcacgatccgcaatgccggc
gaggccgcggtccagctgctgaaccggcactggatcatccgcgatgcccgcgatcagacc
caggaagtgcgcggcgagggcgtggtcggcaaacagccccggatcccgcccggcgaggag
ttcgagtacaccagcggcacggtactcgagacgccggtcggcacaatggaaggcagctac
cagatgcgcgacgactcgggtttcaccttcgaggccccgattccgccgttcaccctctcg
gtcccgcattcgctgcactga

DBGET integrated database retrieval system