KEGG   Thioalkalivibrio paradoxus: THITH_07015Help
Entry
THITH_07015       CDS       T03590                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tti  Thioalkalivibrio paradoxus
Pathway
tti00071  Fatty acid degradation
tti00280  Valine, leucine and isoleucine degradation
tti00310  Lysine degradation
tti00362  Benzoate degradation
tti00380  Tryptophan metabolism
tti00620  Pyruvate metabolism
tti00630  Glyoxylate and dicarboxylate metabolism
tti00640  Propanoate metabolism
tti00650  Butanoate metabolism
tti00900  Terpenoid backbone biosynthesis
tti01100  Metabolic pathways
tti01110  Biosynthesis of secondary metabolites
tti01120  Microbial metabolism in diverse environments
tti01130  Biosynthesis of antibiotics
tti01200  Carbon metabolism
tti01212  Fatty acid metabolism
tti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THITH_07015
   00630 Glyoxylate and dicarboxylate metabolism
    THITH_07015
   00640 Propanoate metabolism
    THITH_07015
   00650 Butanoate metabolism
    THITH_07015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    THITH_07015
   00072 Synthesis and degradation of ketone bodies
    THITH_07015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THITH_07015
   00310 Lysine degradation
    THITH_07015
   00380 Tryptophan metabolism
    THITH_07015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THITH_07015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    THITH_07015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    THITH_07015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tti04147]
    THITH_07015
Enzymes [BR:tti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     THITH_07015
Exosome [BR:tti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THITH_07015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHE98047
UniProt: W0DLA4
Position
complement(1457479..1458807)
Genome map
AA seq 442 aa AA seqDB search
MTAAASHLPGRPVYLIDGLRSPFLKVRGGPGAFRASDLAVAAARAVLLRQPFAPTDLDEV
ILGCAAPGPDEANIGRVVALRLGCGHRVPGWTVQRNCASGMQAIDSAAKDIALGRADLVL
AGGTEAMSHHPVLLRPEMVDWLARYRQARGAAARLRLLARLRPRYLKPVIGLLRGLTDPV
VGLGMGQTAEIVAERFRIGRAEMDAFALHSHRRLAQARAEGRMAAEIVPLYDGTRVLEHD
DGLRADSSADALARLRPTFDRPHGRVTAGNSAQVTDGAAWLLLASANALERHRLRARARI
VDVAWAGLDPAQMGLGPAYAIAQLLDRHGLDTPEIDFWEINEAFAAQVLACLQALADPGF
CRDELQRDRPFPAIGPETLNVDGGGISLGHPVGASGARITLHLLRVLEARGTRRGVASLC
IGGGQGGALLLERDAAPLETTS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgccgccagccacctccccggccgcccggtctacctgatcgacggtctgcgc
agcccgttcctgaaagtgcgtggtggccccggggcgtttcgggcatccgatctcgcggtg
gccgcggcccgtgcagtgctgctgcgtcagccgttcgcaccaaccgacctcgacgaagtg
atcctcggctgtgccgccccgggcccggacgaggcgaacatcggccgggtggtcgcactg
cggctgggctgcgggcaccgggttccgggctggaccgtgcagcgcaactgcgcgtccgga
atgcaggccatcgacagcgccgcgaaggacatcgcgctcggacgcgccgacctggtcctt
gccggaggcaccgaagccatgagccaccacccggtgctgctgcgcccggagatggtcgac
tggctcgcgcgttatcgacaggcacggggggctgcggcacggctgcggctgctggcgcgc
ctgcggccccgatacctgaagccggtgatcggcctgctgcgcggcctgaccgacccggtg
gtcgggctgggcatgggccagactgccgaaatcgtcgcggaacgcttccggattggccgt
gccgagatggacgcgttcgcgctgcacagccatcgccgcctggcacaggcacgcgcagag
ggccggatggccgccgagatcgtgccgctgtacgacggcacccgggtactcgagcacgac
gacggcctgcgcgccgattcgtcggcggacgctctggcacgcctgcgcccaacgttcgac
cggccgcacgggcgagtcaccgcgggcaactccgcgcaggtcaccgatggcgcagcctgg
ctgctgctggcctcggccaacgccctggaacgacaccgcctgcgggcgcgcgcgcggatc
gtcgatgtggcctgggccgggctcgacccggcgcagatgggcctcgggccggcctacgcg
atcgctcaactgttggaccggcacgggctggacactcccgaaatcgatttctgggagatc
aacgaggcgtttgccgcgcaggtgctggcgtgcctgcaggcgctcgccgatcccggcttc
tgccgcgacgagctgcaacgcgaccggccgttcccggcgatcggcccggaaaccctgaac
gtggacggcggcggcatcagcctcggtcacccggtcggggccagcggcgcccggatcacg
ctgcacctgctgcgggtgctcgaagcccgaggcacccgccgcggtgtcgcgagtctgtgc
atcggcggcggccagggcggcgcgctgctgctcgaacgcgacgccgcgcccctggagacg
acgtcatga

DBGET integrated database retrieval system