KEGG   Thioalkalivibrio paradoxus: THITH_17385Help
Entry
THITH_17385       CDS       T03590                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tti  Thioalkalivibrio paradoxus
Pathway
tti00020  Citrate cycle (TCA cycle)
tti00310  Lysine degradation
tti00380  Tryptophan metabolism
tti01100  Metabolic pathways
tti01110  Biosynthesis of secondary metabolites
tti01120  Microbial metabolism in diverse environments
tti01130  Biosynthesis of antibiotics
tti01200  Carbon metabolism
Module
tti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THITH_17385
  09105 Amino acid metabolism
   00310 Lysine degradation
    THITH_17385
   00380 Tryptophan metabolism
    THITH_17385
Enzymes [BR:tti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     THITH_17385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AHE99770
UniProt: W0DSE3
Position
complement(3725845..3727161)
Genome map
AA seq 438 aa AA seqDB search
MSSERTVLRVPELPESVADATVVALHKQPGERVRRDELLVELETDKVVLEVPAPADGVLD
EFSVEQGAVVEADTVLGYIRPAAADGGSAEDREPPAQPADADDAGPEMPAPERQPERSAA
PETAPPPPSPAVRRLLAEHDLAADEIEGTGQNGRVLKGDVERFIARRAQSEPDPEPVAEA
PPQPRAEPEPPEQPQEPQPAARSPEGRSEERVPMSRLRRRIAERLLEARQTTAMLTTFNE
VDLSAVMDLRARHKEAFEKRHGVRLGFMSFFVRACTGALQRFPVVNAALDGDEIVYHHYA
DIGIAVSSPRGLVVPVLRDAGELSLAAIETQIRRFAEKARDGKLDVDDLRGGTFTITNGG
VFGSLLSTPILNPPQSAILGMHAVQDRPVARDGEVVIRPMMYVALSYDHRLIDGADAVRF
LVSVKDSLEDPGRMLLDL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagaacgtaccgtcctccgggtccccgaactgccggaatccgtggccgatgcc
accgtggtcgcgctgcacaagcagccgggcgagcgtgtccggcgcgacgaactgctggtc
gaactcgagaccgacaaggtcgtgctcgaagttccggccccggccgacggcgtgctcgac
gagttcagcgtcgaacaaggcgcggtggtcgaggccgacacggtgcttggctatatcagg
ccggcggccgccgacggcggcagcgccgaagaccgcgaaccacccgcgcagcctgccgat
gccgatgacgccgggccggagatgccggcgcctgagcgtcagcccgagcggtccgccgcc
cccgagacggcgccgccgcccccgagcccggcggtccgccgcctgctggccgagcacgac
ctcgctgccgacgagatcgaaggcacgggccagaacggacgcgtgctgaagggtgatgtt
gagcgcttcattgcccggcgcgcgcaatccgagccggacccggagccggtcgcagaggcg
ccgccgcagccccgcgcggagccggaaccgcccgagcagccgcaagagccacaacccgcc
gctcggtccccggagggccgcagcgaggaacgcgtgccgatgtcgcggctgcgcaggcgc
attgccgagcgcctgctcgaggccaggcagaccaccgcaatgctgaccaccttcaacgag
gtcgatctgtcggccgtgatggacctgcgcgcgcggcacaaggaggcgttcgaaaagcgg
cacggcgtgcgcctggggttcatgagcttcttcgtgcgcgcctgcaccggcgctctgcag
cggtttccggtggtcaatgccgcgctggacggcgacgagatcgtctaccaccactacgcc
gatatcggcatcgcggtatcgtcgccgcgcggcctggtggtgccggtactgcgcgacgcc
ggggagctttcgctggcagccatcgaaacgcagatccgccgctttgcggaaaaggcgcgg
gacggcaagctggatgtcgacgacctgcgcggcggcaccttcaccatcaccaacgggggc
gtgttcggctcgctgctgtcgacgccgatcctgaatccgccgcagagcgcgatcctgggc
atgcacgcggtgcaggaccgccccgtggcgcgcgacggcgaggttgtgatccggccgatg
atgtacgtcgcgctgtcctacgatcaccggctgatcgacggcgccgatgcggtgcgcttt
ctggtcagcgtgaaggactcgctggaagaccccggccggatgctgctggatctgtag

DBGET integrated database retrieval system