KEGG   Thermus thermophilus HB8: TTHA0001
Entry
TTHA0001          CDS       T00220                                 
Symbol
TTHA0001
Name
(GenBank) DNA polymerase III, beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03430  Mismatch repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA0001 (TTHA0001)
   03430 Mismatch repair
    TTHA0001 (TTHA0001)
   03440 Homologous recombination
    TTHA0001 (TTHA0001)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA0001 (TTHA0001)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0001 (TTHA0001)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TTHA0001 (TTHA0001)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     TTHA0001 (TTHA0001)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     TTHA0001 (TTHA0001)
SSDB
Motif
Pfam: DNA_pol3_beta_3 DNA_pol3_beta_2 DNA_pol3_beta
Other DBs
NCBI-ProteinID: BAD69824
UniProt: Q5SME2
Position
1:55..1182
AA seq 375 aa
MNITVPKKLLSDQLSLLERIVPSRSANPLYTYLGLYAEEGALILFGTNGEVDLEVRLPAE
AQSLPRVLVPAQPFFQLVRSLPGDLVALGLASEPGQGGQLELSSGRFRTRLSLAPAEGYP
ELLVPEGEDKGAFPLRTRMPSGELVKALTHVRYAASNEEYRAIFRGVQLEFSPQGFRAVA
SDGYRLALYDLPLPQGFQAKAVVPARSVDEMVRVLKGADGAEADLALGEGVLALALEGGS
GVRMALRLMEGEFPDYQRVIPQEFALKVQVEGEALREAVRRVSVLSDRQNHRVDLLLEEG
RILLSAEGDYGKGQEEVPAQVEGPGMAVAYNARYLLEALAPVGDRAHLGISGPTSPSLIW
GDGEGYRAVVVPLRV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaacataacggttcccaaaaaactcctctcggaccagctttccctcctggagcgcatc
gtcccctctagaagcgccaaccccctctacacctacctggggctttacgccgaggaaggg
gccttgatcctcttcgggaccaacggggaggtggacctcgaggtccgcctccccgccgag
gcccaaagccttccccgggtgctcgtccccgcccagcccttcttccagctggtgcggagc
cttcctggggacctcgtggccctcggcctcgcctcggagccgggccagggggggcagctg
gagctctcctccgggcgcttccgcacccggctcagcctggcccctgccgagggctacccc
gagcttctggtgcccgagggggaggacaagggggccttccccctccggacgcggatgccc
tccggggagctcgtcaaggccttgacccacgtgcgctacgccgcgagcaacgaggagtac
cgggccatcttccgcggggtgcagctggagttctccccccagggcttccgggcggtggcc
tccgacgggtaccgcctcgccctctacgacctgcccctgccccaagggttccaggccaag
gccgtggtccccgcccggagcgtggacgagatggtgcgggtcctgaagggggcggacggg
gccgaggccgacctcgccctgggcgagggggtgttggccctggccctcgagggcggaagc
ggggtccggatggccctccgcctcatggaaggggagttccccgactaccagagggtcatc
ccccaggagttcgccctcaaggtccaggtggagggggaggccctcagggaggcggtgcgc
cgggtgagcgtcctctccgaccggcagaaccaccgggtggacctccttttggaggaaggc
cggatcctcctctccgccgagggggactacggcaaggggcaggaggaggtgcccgcccag
gtggaggggccgggcatggccgtggcctacaacgcccgctacctcctcgaggccctcgcc
cccgtgggggaccgggcccacctgggcatctccgggcccacgagcccgagcctcatctgg
ggggacggggaggggtaccgggcggtggtggtgcccctcagggtctag

DBGET integrated database retrieval system