KEGG   Thermus thermophilus HB8: TTHA0078
Entry
TTHA0078          CDS       T00220                                 
Symbol
TTHA0078
Name
(GenBank) conserved hypothetical protein
  KO
K19091  CRISPR-associated endoribonuclease Cas6 [EC:3.1.-.-]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ttj02048]
    TTHA0078 (TTHA0078)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     TTHA0078 (TTHA0078)
Prokaryotic defense system [BR:ttj02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-A factors
    TTHA0078 (TTHA0078)
   Subtype I-D factors
    TTHA0078 (TTHA0078)
SSDB
Motif
Pfam: CRISPR_Cas6 CRISPR_Cas6_N
Other DBs
NCBI-ProteinID: BAD69901
UniProt: Q5SM65
Structure
Position
1:complement(79613..80332)
AA seq 239 aa
MVLAALVLVLEGEGLPEPLGLRGFFYGLLREVAPEVHDQGENPFALGFGGREGAAWARVS
LLVEGLYARLAPRLYALEGEEVRLGPPFRVRAVLQEGHPWAGVSTYPRLFQGPPSRDLAL
RFASPTFFRRKGVHYPVPEPRLVLESLLRRLEAFGPLKAPEGVREALLERTTVRSLEGRT
LPARTEVDTAGFVGRVVYHLPRATEEEALWLSALGRFAFYSGVGAKTSLGYGRARAESA
NT seq 720 nt   +upstreamnt  +downstreamnt
gtggtcctcgccgccttggtcctggtcctcgagggagaaggcctccccgagcccttgggc
ctcaggggcttcttctacggcctccttcgggaggtggccccggaggtgcacgaccagggg
gaaaaccccttcgccctgggcttcggggggcgggagggggcggcttgggcccgggtgagc
ctgcttgtggaagggctttacgcccgcctcgccccccgcctctacgccctggagggggag
gaggtgcggcttgggccccctttccgggtgcgggccgtgctccaggaggggcacccctgg
gcgggggtttccacctatccccgcctctttcaggggcctccttcccgggacctcgccctg
cgcttcgccagccccaccttcttccgcagaaaaggggtccactacccggtccccgagccg
aggttggttttggaaagcctcctccggcgcctcgaggcctttggccccctgaaggccccg
gaaggggtgagggaggcccttttggagaggaccacggtgcggagcctggaggggcggacc
ctccccgcccgcacggaggtggacaccgcgggcttcgtggggcgggtggtctaccacctg
ccccgggccacggaggaggaggccctttggctttccgccctaggccgcttcgccttctat
agcggcgtgggggccaagacctccttgggctacggccgcgcccgggcggaaagtgcctaa

DBGET integrated database retrieval system