KEGG   Thermus thermophilus HB8: TTHA0086Help
Entry
TTHA0086          CDS       T00220                                 

Definition
(RefSeq) NADH-quinone oxidoreductase subunit 5
  KO
K00332  NADH-quinone oxidoreductase subunit C [EC:7.1.1.2]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00190  Oxidative phosphorylation
ttj01100  Metabolic pathways
Module
ttj_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TTHA0086
Enzymes [BR:ttj01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     TTHA0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 3168317
NCBI-ProteinID: YP_143352
UniProt: Q56219
Structure
PDB: 

Position
84664..85287
Genome map
AA seq 207 aa AA seqDB search
MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTY
PDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYD
LFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPG
LTFYKGGSRKGYRSLWADLKKAREVKG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttgagcgcgtcctggaagaggcccgggccaagggctaccccatagaggacaac
ggcctcggcaacctctgggtggtcctgcccagggagcgcttcaaggaggagatggcccac
tacaaggccatggggttcaacttcctggccgacatcgtgggcctggactacctgacctac
ccggacccccgccccgagcgcttcgccgtggtctacgagctcgtctccctcccgggctgg
aaggacggggacgggagccgcttcttcgtgcgggtctacgtgcccgaagaggaccccagg
ctccccacggtcaccgacctctgggggagcgccaatttcctggaaagggaggtctacgac
ctcttcggcatcgtctttgaaggccaccccgacctccgcaagatcctcaccccggaggac
ctcgagggccaccccctgcgcaaggactaccccttgggcgagacccccaccctcttccgc
gaggggcggtacatcatcccggcggagttccgcgccgccctcaccggcaaggaccccggc
ctcaccttctacaagggcgggagccgcaagggctacaggtccctttgggccgacctgaag
aaggcccgggaggttaaaggatga

DBGET integrated database retrieval system