KEGG   Thermus thermophilus HB8: TTHA0112
Entry
TTHA0112          CDS       T00220                                 
Symbol
TTHA0112
Name
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TTHA0112 (TTHA0112)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0112 (TTHA0112)
Enzymes [BR:ttj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     TTHA0112 (TTHA0112)
DNA repair and recombination proteins [BR:ttj03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     TTHA0112 (TTHA0112)
 Prokaryotic type
     TTHA0112 (TTHA0112)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: BAD69935
UniProt: Q5SM31
Position
1:complement(112318..112980)
AA seq 220 aa
MGGVACPKEGPKEKKARAREVLKALKAAYPGARTELRHENPFQLLVATVLSAQATDKSVN
EATPALFARFPDAKALAEATPEEVEPYIRRIGLYRTKAKNLVALARRLVEEYGGEVPKEK
EALMRLPGVGWKTATVVLGAAFGVPGIAVDTHVARLARRLCFSEAKAPERIGKDLEALFP
KEDWVFVHHALVLHGRYVCTARRPRCRACVLAPYCPSREA
NT seq 663 nt   +upstreamnt  +downstreamnt
gtggggggcgtggcgtgccctaaggaagggccaaaggagaagaaggcccgggcccgggag
gtcttaaaggccctcaaggccgcctaccccggggcccgcacggagcttaggcacgagaac
cccttccagctcctcgtggccacggtcctctccgcccaggccaccgataaaagcgtgaac
gaggccaccccggccctcttcgcccgctttcccgacgccaaggccctggcggaggccacc
cccgaggaggtggagccctacatccgccgcatcgggctttaccgcaccaaggcgaagaac
ctcgtggccctggcgaggaggctcgtggaggagtacgggggagaggtgcccaaggagaag
gaggccctcatgcgccttcccggggtgggctggaagacggccaccgtggtgctgggggcg
gcctttggggtgccggggatcgccgtggacacccacgtggcccgcctcgccaggaggctc
tgcttctccgaggccaaggccccggagaggatcgggaaggacctcgaggccctcttcccc
aaggaggactgggtcttcgtccaccacgccctcgtcctccacggccgctacgtctgcacc
gcaaggaggccccgctgccgggcctgcgtccttgcgccctactgcccgagccgcgaggcc
tga

DBGET integrated database retrieval system