KEGG   Thermus thermophilus HB8: TTHA0130
Entry
TTHA0130          CDS       T00220                                 
Symbol
TTHA0130
Name
(GenBank) deoxycytidine triphosphate deaminase
  KO
K01494  dCTP deaminase [EC:3.5.4.13]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00240  Pyrimidine metabolism
ttj01100  Metabolic pathways
ttj01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    TTHA0130 (TTHA0130)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     TTHA0130 (TTHA0130)
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: BAD69953
UniProt: Q5SM13
Position
1:complement(128065..128610)
AA seq 181 aa
MVKPDWWIREMARKGMIEPFEERLVREGVISYGLSSFGYDLRAAPEWKIFTNVFSSLVDP
KNFDPKSFVEYEGEEVVIPPNSFALTRSLEYIRMPDNVIAIALGKSTYARCGIVVNVTPL
EPGWEGHVTLEISNTTPLPAKVYAGEGIVQLLFLEGPRPEVTYRDRKGKYQGQKGITLPR
V
NT seq 546 nt   +upstreamnt  +downstreamnt
atggtgaagccggactggtggatccgggagatggcgcgaaagggcatgattgagcccttt
gaggaaaggctcgtgcgggagggggtcatcagctacgggctttcctccttcgggtacgac
ctccgggccgcccccgagtggaagatcttcaccaacgtcttctccagcctggtggacccc
aagaactttgaccccaagagcttcgtggagtacgagggggaggaggtggtgatcccccca
aactccttcgccctcacccggagcctggagtacatccgcatgcccgacaacgtgatcgcc
atcgccctgggcaagagcacctacgcccggtgcggcatcgtggtgaacgtgacgcctctg
gagcccggctgggaaggccacgtcaccctggagatctccaacaccactccccttcccgcc
aaggtctacgcaggcgaaggcatcgtccagctcctcttcctggagggcccccgccccgag
gtcacctaccgggaccgcaaagggaagtaccaggggcagaaggggatcaccctcccccgg
gtttag

DBGET integrated database retrieval system