KEGG   Thermus thermophilus HB8: TTHA0152Help
Entry
TTHA0152          CDS       T00220                                 

Definition
(RefSeq) tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00030  Pentose phosphate pathway
ttj01100  Metabolic pathways
ttj01120  Microbial metabolism in diverse environments
ttj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTHA0152
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TTHA0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-GeneID: 3168554
NCBI-ProteinID: YP_143418
UniProt: Q5SLZ1
Position
complement(145876..147702)
Genome map
AA seq 608 aa AA seqDB search
MLGGYAHRIARIDLSTGQVEYFAPDPKDLEMYVGGRGLGVKYVFENGPQVDPLGPENLLC
IMNGPLSGTRAKMSGRLAVVTKSPLTGTVTDSHMGGWTAAKLKWAGFDGLLIKGASEKPV
YLLVKDGEVSIHDASDLWGKTTHETCRILRERHGEEADVMAIGPAGENLVRFANWINNDE
RAAGRGGTGAVAGSKKLKAIVVVGTHDKMPQPKDPELWKEADRLASATINDPKNVTAPKK
GGLSLYGTNVLMNITNVMGALPTFNAQHTCIEGAEKISGEYIREHRLIKDNTCHACPVAC
KKMVEVHINGKTIRFESYEYESAWALGAHSGHTDTDWTGYAIYLCNAYGMDTIEAGNAIA
VLMEATEKGYYQGEDGIRFGDKEGEIRVLEAIAYRKGVGDMLAEGPARFAKAIGHPEIAL
EVKGQSIPAYDPRGLKGMGIAYATSNRGACHLRAYTPASEILGVPYKTDPLAWEGKGKLT
KLFQDLSAFTDSLDLCKFSQFAEGPEEYAKQLAAYWGRPVTPEEILRIGERIYNLERYYN
NLAGWGEGSDYLPERFLKEPSDCAGSKGQVTELDRMLEEYYRERGWERGVVPPAKLQELG
ILSQAADD
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcggatatgcccataggattgcccgtattgacctgagcacgggccaggtggag
tacttcgcccccgaccccaaggacctggagatgtacgtgggggggcggggcctcggggtg
aagtacgtgtttgagaacggcccccaggtggaccccctgggcccggagaacctcctctgc
atcatgaacggccccctctccggcacccgggccaagatgtcgggaaggctcgccgtggtc
accaaaagccccctcacgggcacggtgacggacagccacatggggggctggaccgcggcc
aagctcaagtgggcggggtttgacggcctcctcatcaagggggcttcggaaaaacccgtc
taccttctggtgaaggacggggaggtctccatccacgacgcctccgacctctggggcaag
accacccacgagacctgccgcatcctccgggagcggcacggggaggaggccgacgtgatg
gccatcggccctgccggggagaacctggtgcgcttcgccaactggatcaacaacgacgag
cgggccgcaggccgtgggggcaccggggcggtggcggggagcaagaagctcaaggccatc
gtggtggtgggcacccacgacaagatgccccagcccaaggaccccgagctctggaaggag
gcggaccggctggcctcggccaccatcaacgaccccaagaacgtcaccgcccccaagaag
ggcgggctttccctctacggcaccaacgtcctcatgaacatcaccaacgtcatgggggcc
ctgcccacctttaacgcccagcacacctgcattgagggggcggagaagatctccggggag
tacatccgcgagcaccgcctcatcaaggacaacacctgccacgcctgccccgtggcctgc
aagaagatggtggaggtccacatcaacggcaagaccatccgctttgagtcctacgagtac
gagtccgcctgggccctgggggcccactcgggccacacggacaccgactggacgggctac
gccatctacctctgcaacgcctacggcatggacaccattgaggcgggcaacgccatcgcc
gtcctcatggaggccacggagaagggctactaccagggcgaggacgggatccgcttcggg
gacaaggagggggagatccgggtcctcgaggccatcgcctaccgcaagggcgtgggggac
atgctcgcggaaggcccggcccgcttcgccaaggccatcggccaccccgagatcgccctg
gaggtcaagggccagtccatccccgcctacgacccccggggcctcaagggcatgggcatc
gcctacgccacctccaaccggggggcctgccacctccgggcctacaccccggcctcggag
atcctgggcgtgccctacaagaccgaccctctggcctgggaggggaagggcaagctcacc
aagctcttccaggacctctccgccttcaccgactccctggacctttgcaagttcagccag
ttcgccgagggccccgaggagtacgccaagcagctcgccgcctactggggccgccccgtg
acccccgaggagatcctgaggatcggggagcgcatctacaacctggagcgctactacaac
aacctggcgggctggggcgagggctcggactacctgcccgagcgcttcctcaaggagccc
tccgactgcgcgggctccaagggccaggtcaccgagctggaccggatgctggaggagtac
taccgggagcggggctgggagcggggcgtggttcccccggccaagctccaggagctcggc
atcctctcccaggcggcggacgactag

DBGET integrated database retrieval system