KEGG   Thermus thermophilus HB8: TTHA0180
Entry
TTHA0180          CDS       T00220                                 
Symbol
TTHA0180
Name
(GenBank) DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03430  Mismatch repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA0180 (TTHA0180)
   03430 Mismatch repair
    TTHA0180 (TTHA0180)
   03440 Homologous recombination
    TTHA0180 (TTHA0180)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA0180 (TTHA0180)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0180 (TTHA0180)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TTHA0180 (TTHA0180)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     TTHA0180 (TTHA0180)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     TTHA0180 (TTHA0180)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP LAGLIDADG_3 Intein_splicing HHH_6 tRNA_anti-codon HHH_3
Other DBs
NCBI-ProteinID: BAD70003
UniProt: Q5SLW3
Position
1:complement(171503..177706)
AA seq 2067 aa
MGRKLRFAHLHQHTQFSLLDGAAKLSDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKKA
TEMGIKPILGYEAYVAAESRFDRKRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYLEG
FYEKPRIDREILREHAEGLIALSGCLGAEIPQFILQDRLDLAEARLNEYLSIFKDRFFIE
IQNHGLPEQKKVNEVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKSTLDDPG
RWRFPCDEFYVKTPEEMRAMFPEEEWGDEPFDNTVEIARMCNVELPIGDKMVYRIPRFPL
PEGRTEAQYLMELTFKGLLRRYPDRITEGFYREVFRLLGKLPPHGDGEALAEALAQVERE
AWERLMKSLPPLAGVKEWTAEAIFHRALYELSVIERMGFPGYFLIVQDYINWARRNGVSV
GPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYV
RERYGEDKVAQIGTLGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAIQ
VVPELRAEMEKDPKVREVLEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRDQEGRP
VTQYDMGAVEALGLLKMDFLGLRTLTFLDEVKRIVKASQGVELDYDALPLDDPKTFALLS
RGETKGVFQLESGGMTATLRGLKPRRFEDLIAILSLYRPGPMEHIPTYIRRHHGLEPVSY
SEFPHAEKYLKPILDETYGIPVYQEQIMQIASAVAGYSLGEADLLRRCLAEGSLVLDAAT
GQRVPIEKVRPGMEVFSLGPDYRLYRVPVLEVLESGVREVVRLRTRSGRTLVLTPDHPLL
TPEGWKPLCDLPLGTPIAVPAELPVAGHLAPPEERVTLLALLLGDGNTKLSGRRGTRPNA
FFYSKDPELLAAYRRCAEALGAKVKAYVHPTTGVVTLATLAPRPGAQDPVKRLVVEAGMV
AKAEEKRVPEEVFRYRREALALFLGRLFSTDGSVEKKRISYSSASLGLAQDVAHLLLRLG
ITSQLRSRGPRAHEVLISGREDILRFAELIGPYLLGAKRERLAALEAEARRRLPGQGWHL
RLVPPAVAYRISEAKRRSGLSWSEAGRRVAVAGSCLSSGLNLKRPRRYLFRHRLFLLGEA
FADPGLEALAEGQVLWDPIVAVEPAGKARTFDLRVPPFANFVSEDLVVHNSMGKKKVEEM
KSHRERFVQGAKERGVPEEEANRLFDMLEAFANYGFNKCLPARARVVDWCTGRVVRVGEI
VRGEAKGVWVVSLDEARLRLVPRPVVAAFPSGKAQVYALRTATGRVLEATANHPVYTPEG
WRPLGTLAPGDYVALPRHLSYRPSLHLEGHELDLLGFALAEGHLRHPSGVYLYTSSEEEL
AAMEEALRAFPNTRIRVVWRRGVAHVYVGRVDRRQEAGAVAFLRRMGLLGLDAKTKRLPE
AVFGLPPEEVARFLGRLWTGDGGVDPKGRLIHYATASKELAWGVQHLLLRLGLQSRLVEK
RFSGGYKGYAVYLLGGLEAARRFAETVGPYLVGKRRQDLEALLASWEKAGRSTRDVLPLA
FLEEVRAAVAEVAQGQVADLLREAGLAEGLLCLGRGRRGLSRATVGRLAALTGSLALLRL
AEAEVYWDRVEAVEPLGEEEVFDLTVEGTHTFVAEDVIVHNSHAAAYSLLSYQTAYVKAH
YPVEFMAALLSVERHDSDKVAEYIRDARAMGIEVLPPDVNRSGFDFLVQGRQILFGLSAV
KNVGEAAAEAILRERERGGPYRSLGDFLKRLDEKVLNKRTLESLIKAGALDGFGERARLL
ASLEGLLKWAAENREKARSGMMGLFSEVEEPPLAEAAPLDEITRLRYEKEALGIYVSGHP
ILRYPGLRETATCTLEELPHLARDLPPRSRVLLAGMVEEVVRKPTKSGGMMARFVLSDET
GALEAVAFGRAYDQVSPRLKEDTPVLVLAEVEREEGGVRVLAQAVWTYEELEQVPRALEV
EVEASLLDDRGVAHLKSLLDEHAGTLPLYVRVQGAFGEALLALREVRVGEEALGALEAAG
FRAYLLPDREVLLQGGQAGEAQEAVPF
NT seq 6204 nt   +upstreamnt  +downstreamnt
atgggccgcaagctccgcttcgcccacctccaccagcacacccagttctccctcctggac
ggggcggcgaagctttccgacctcctcaagtgggtcaaggagacgacccccgaggacccc
gccttggccatgaccgaccacggcaacctcttcggggccgtggagttctacaagaaggcc
accgaaatgggcatcaagcccatcctgggctacgaggcctacgtggcggcggaaagccgc
tttgaccgcaagcggggaaagggcctagacgggggctactttcacctcaccctcctcgcc
aaggacttcacggggtaccagaacctggtgcgcctggcgagccgggcttacctggagggg
ttttacgaaaagccccggattgaccgggagatcctgcgcgagcacgccgagggcctcatc
gccctctcggggtgcctcggggcggagatcccccagttcatcctccaggaccgtctggac
ctggccgaggcccggctcaacgagtacctctccatcttcaaggaccgcttcttcattgag
atccagaaccacggcctccccgagcagaaaaaggtcaacgaggtcctcaaggagttcgcc
cgaaagtacggcctggggatggtggccaccaacgacggccattacgtgaggaaggaggac
gcccgcgcccacgaggtcctcctcgccatccagtccaagagcaccctggacgaccccggg
cgctggcgcttcccctgcgacgagttctacgtgaagacccccgaggagatgcgggccatg
ttccccgaggaggagtggggggacgagccctttgacaacaccgtggagatcgcccgcatg
tgcaacgtggagctgcccatcggggacaagatggtctaccgcatcccccgcttccccctc
cccgaggggcggaccgaggcccagtacctcatggagctcaccttcaaggggctcctccgc
cgctacccggaccggatcaccgagggcttctaccgggaggtcttccgccttttggggaag
cttcccccccacggggacggggaggccttggccgaggccttggcccaggtggagcgggag
gcttgggagaggctcatgaagagcctcccccctttggccggggtcaaggagtggacggcg
gaggccattttccaccgggccctttacgagctttccgtgatagagcgcatggggtttccc
ggctacttcctcatcgtccaggactacatcaactgggcccggagaaacggcgtctccgtg
gggcccggcagggggagcgccgccgggagcctggtggcctacgccgtggggatcaccaac
attgaccccctccgcttcggcctcctctttgagcgcttcctgaacccggagagggtctcc
atgcccgacattgacacggacttctccgaccgggagcgggaccgggtgatccagtacgtg
cgggagcgctacggcgaggacaaggtggcccagatcggcaccctgggaagcctcgcctcc
aaggccgccctcaaggacgtggcccgggtctacggcatcccccacaagaaggcggaggaa
ttggccaagctcatcccggtgcagttcgggaagcccaagcccctgcaggaggccatccag
gtggtgccggagcttagggcggagatggagaaggaccccaaggtgcgggaggtcctcgag
gtggccatgcgcctggagggcctgaaccgccacgcctccgtccacgccgccggggtggtg
atcgccgccgagcccctcacggacctcgtccccctcatgcgcgaccaggaagggcggccc
gtcacccagtacgacatgggggcggtggaggccttgggccttttgaagatggactttttg
ggcctccgcaccctcaccttcctggacgaggtcaagcgcatcgtcaaggcgtcccagggg
gtggagctggactacgatgccctccccctggacgaccccaagaccttcgccctcctctcc
cggggggagaccaagggggtcttccagctggagtcgggggggatgaccgccacgctccgc
ggcctcaagccgcggcgctttgaggacctgatcgccatcctctccctctaccgccccggg
cccatggagcacatccccacctacatccgccgccaccacgggctggagcccgtgagctac
agcgagtttccccacgccgagaagtacctaaagcccatcctggacgagacctacggcatt
cccgtctaccaggagcagatcatgcagatcgcctcggccgtggcggggtactccctgggc
gaggcggacctcctccggcggtgtttggcggagggaagtctggtcctggatgcggctacg
ggtcagagggtgcccatagagaaggtgcggcccggcatggaggtcttctccctcggcccc
gattaccgcctctaccgggtcccggtgctggaggttctggaaagcggcgtccgggaggtg
gtgcggctcaggacccggagcggccgcaccctagtcctcacccctgaccaccctctcctg
accccggaagggtggaagcccctttgcgacctgcccctgggtacgcccatcgctgtacct
gccgaacttcctgtggccggacatctcgccccacccgaagaacgggttaccctcttggcc
ttgctgctaggggacggtaacacgaagctctccggccgcagggggacgaggccgaacgcc
ttcttctactccaaggaccccgagctcctggccgcctatcggcggtgcgccgaggctttg
ggggccaaggtcaaagcctacgtccaccccaccacgggggtggtgaccttagccaccctg
gccccgaggcccggggcccaggatccggtgaagcgcctggtggtggaggccgggatggtg
gccaaggcagaggagaagcgggtacccgaggaggtgttccgctaccgcagggaggccttg
gccctcttccttggccgcctcttcagcaccgatggctccgtggagaaaaagcgcatctcg
tacagctcggccagcctaggtttggcgcaggacgtggcccacctcctcctccgcctggga
atcacgagccaactgcgctccaggggacctcgagcccacgaggttctgatctcgggccgg
gaggatatccttcgctttgctgagctcatcggcccctatctcttgggggctaagcgcgaa
cggttggctgccttggaggctgaagccagaagacgccttcctggccagggctggcacctt
cgcctcgtgcctcctgcggtggcctaccgcatctcggaggccaagagaaggagcgggctt
tcctggagtgaggcggggagaagggtcgccgtagcggggagctgcctctccagcggtctt
aacctcaagcgcccccgccgctacctcttccgccaccgcctcttcctcctgggggaggcc
tttgccgacccgggcctcgaggccttggcagaaggtcaggttctgtgggaccccatcgtg
gcggtagagcctgcgggaaaggcccgcacctttgatctccgggtgccccccttcgccaac
ttcgtgtccgaggaccttgtggtccacaactccatgggcaagaagaaggtggaggagatg
aagtcccaccgggagcgcttcgtccagggggccaaggaaaggggcgtgcccgaggaggag
gccaaccgcctctttgacatgctggaggccttcgccaactacggcttcaacaaatgcctc
cccgcccgggcccgggtggtggactggtgcaccgggagggtggtgcgcgtgggggagatc
gtccggggcgaggcgaagggggtctgggtggtttccctggacgaggcccgcctccgcctg
gtgccgcggcccgtggtggccgccttcccgagcggaaaggcccaggtctacgccctccgc
accgccacgggccgggtcttggaggccacggccaaccaccccgtctacaccccggagggg
tggcggcctttggggaccttggcgcctggggattacgtggccctgccccgccacctctcc
tatcggccttccctccacctggagggccacgagctggaccttttgggcttcgccctggcc
gaaggccatctccgtcacccttccggcgtttacctctatacctcctccgaggaggagctc
gccgccatggaggaggctttgcgggccttccccaacacccgcatccgggtggtctggcgc
cggggggtggcccacgtttacgtaggccgcgtggaccggaggcaagaggcgggcgcggtg
gccttcctgaggcggatggggcttctcgggcttgacgcgaagacgaagcgccttcccgag
gcggtcttcggcctacctcccgaggaggtggcccgctttttggggcggctttggaccggg
gacggcggggtggacccgaaggggaggctcatccactacgccaccgcctccaaggagctc
gcctggggagtgcagcacctcctcctgcgcctggggctccagtcccgcctggtggaaaaa
cgcttttccggggggtacaaggggtatgccgtttacctcctgggggggctggaggcggcc
cgccgcttcgccgaaacggtgggcccctaccttgtgggcaagcggcggcaagacctcgag
gcccttctcgcctcctgggaaaaggcgggccggagcactagagatgtcctccccctcgcc
ttcctggaggaggtgagggcggcggtggccgaggtggcccaagggcaggtggcggacctt
ctccgggaagcgggcttggccgaagggctcctctgcctcggcagggggcggcgggggctt
tcccgggccacggtggggcggcttgccgccctaacggggagcctggcccttctccgcctg
gccgaggccgaggtgtattgggaccgggtggaggccgtggagcccttgggggaggaggag
gtctttgacctcaccgtggaggggacccacacctttgtcgccgaggacgtcatcgtccac
aactcccacgctgccgcctacagcctcctctcctaccagaccgcctacgtgaaggcccac
taccccgtggagttcatggccgccctcctctccgtggagcggcacgactccgacaaggtg
gccgagtacatccgcgacgcccgggccatgggcatagaggtccttcccccggacgtcaac
cgctccgggtttgacttcctggtccagggccggcagatcctcttcggcctctccgcggtg
aagaacgtgggcgaggcggcggcggaggccattctccgggagcgggagcggggcggcccc
taccggagcctcggcgacttcctcaagcggctggacgagaaggtgctcaacaagcggacc
ctggagtccctcatcaaggcgggcgccctggacggcttcggggaaagggcgcggctcctc
gcctccctggaagggctcctcaagtgggcggccgagaaccgggagaaggcccgctcgggc
atgatgggcctcttcagcgaagtggaggagccgcctttggccgaggccgcccccctggac
gagatcacccggctccgctacgagaaggaggccctggggatctacgtctccggccacccc
atcttgcggtaccccgggctccgggagacggccacctgcaccctggaggagcttccccac
ctggcccgggacctgccgccccggtctagggtcctccttgccgggatggtggaggaggtg
gtgcgcaagcccacaaagagcggcgggatgatggcccgcttcgtcctctccgacgagacg
ggggcgcttgaggcggtggccttcggccgggcctacgaccaggtctccccgaggctcaag
gaggacacccccgtgctcgtcctcgccgaggtggagcgggaggaggggggcgtgcgggtg
ctggcccaggccgtttggacctacgaggagctggagcaggtcccccgggccctcgaggtg
gaggtggaggcctccctcctggacgaccggggggtggcccacctgaaaagcctcctggac
gagcacgcggggaccctccccctgtacgtccgggtccagggcgccttcggcgaggccctc
ctcgccctgagggaggtgcgggtgggggaggaggccttgggggccctcgaggccgcgggg
ttccgggcctacctcctgcccgaccgggaggtcctcctccagggcggccaggcgggggag
gcccaggaggcggtgcccttctag

DBGET integrated database retrieval system