KEGG   Thermus thermophilus HB8: TTHA0188Help
Entry
TTHA0188          CDS       T00220                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00230  Purine metabolism
ttj00240  Pyrimidine metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
Module
ttj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ttj_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ttj_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TTHA0188 (ndk)
   00240 Pyrimidine metabolism
    TTHA0188 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ttj04131]
    TTHA0188 (ndk)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     TTHA0188 (ndk)
Membrane trafficking [BR:ttj04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    TTHA0188 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 3169489
NCBI-ProteinID: YP_143454
UniProt: Q5SLV5 Q84CU2
Structure
PDB: 

Position
184971..185384
Genome map
AA seq 137 aa AA seqDB search
MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPG
LVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATL
EDAQREIALFFRPEELL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaccttcgtcatgatcaagcccgacggcgtgcgccggggccttgtgggggag
atcctcgcccggtttgagcgcaaggggttccgcatcgcggccctgaagctcatgcagatc
agccaggagctggcggagcggcactacgccgagcaccgggaaaagcccttcttccccggc
ctcgtgcgcttcatcacctcgggccccgtggtggccatggtcctggaagggccgggggtg
gtggccgaggtgcgcaagatgatgggcgccacccaccccaaggacgccctccccgggacc
atccggggcgacttcgccaccaccattgacgagaacgtgatccacggctccgccaccctc
gaggacgcccagcgggagatcgccctcttcttccgtcccgaggagctcctttaa

DBGET integrated database retrieval system