KEGG   Thermus thermophilus HB8: TTHA0229
Entry
TTHA0229          CDS       T00220                                 
Symbol
TTHA0229
Name
(GenBank) 2-oxoisovalerate dehydrogenase, E1 component alpha subunit
  KO
K00166  2-oxoisovalerate dehydrogenase E1 component subunit alpha [EC:1.2.4.4]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00280  Valine, leucine and isoleucine degradation
ttj00640  Propanoate metabolism
ttj00785  Lipoic acid metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TTHA0229 (TTHA0229)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TTHA0229 (TTHA0229)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    TTHA0229 (TTHA0229)
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     TTHA0229 (TTHA0229)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-ProteinID: BAD70052
UniProt: Q5SLR4
Structure
Position
1:221947..223050
AA seq 367 aa
MVKETHRFETFTEEPIRLIGEEGEWLGDFPLDLEGEKLRRLYRDMLAARMLDERYTILIR
TGKTSFIAPAAGHEAAQVAIAHAIRPGFDWVFPYYRDHGLALALGIPLKELLGQMLATKA
DPNKGRQMPEHPGSKALNFFTVASPIASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSE
GDWYAGINFAAVQGAPAVFIAENNFYAISVDYRHQTHSPTIADKAHAFGIPGYLVDGMDV
LASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDDSRYRPKEEVAFWRKKDPIPRF
RRFLEARGLWNEEWEEDVREEIRAELERGLKEAEEAGPVPPEWMFEDVFAEKPWHLLRQE
ALLKEEL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtcaaggagacccatcggtttgagaccttcaccgaggagcccataaggctcatcggg
gaggaaggggagtggcttggggacttccccttggacctcgagggggagaagctaaggagg
ctctaccgggacatgctggcggcccggatgctggacgaacgctacaccatcctcatccgc
acgggcaagaccagcttcatcgcccccgccgcggggcacgaggccgcccaggtggccatc
gcccacgccatccggccgggctttgactgggtcttcccctactaccgcgaccacggcctg
gccctcgccctagggatccccctcaaggagctcctcggccagatgctcgccaccaaggcc
gaccccaacaagggccgccagatgcccgagcaccccggctccaaggccctcaacttcttc
accgtggcgagccccatcgcctcccacgtccctcccgccgcaggcgccgccatcagcatg
aagctcctgcgcacgggccaggtggcggtctgcaccttcggggacggggccacgagcgaa
ggggactggtacgccgggatcaacttcgccgccgtgcagggggcgccggcggtcttcatc
gccgagaacaacttctacgccatcagcgtggactaccgccaccagacccacagccccacc
atcgccgacaaagcccacgccttcggcattcccggctacctggtggacgggatggacgtg
ctggcgagctactacgtggtcaaggaggcggtggaaagggcgcgaaggggggagggcccg
agcctcgtggagctcagggtctaccgctacgggccccactcctccgccgacgacgacagc
cgctatcggcccaaggaggaggtggccttctggcggaagaaggaccccatcccccgcttc
cggcgcttcctcgaggccaggggcctctggaacgaggagtgggaggaggacgtgcgggag
gagatccgggccgagctggaacggggcctcaaggaggcggaagaagcgggccccgtgccc
cccgagtggatgtttgaggacgtcttcgccgagaagccctggcacctcttgcgccaggag
gccctcctcaaggaggagctctag

DBGET integrated database retrieval system