KEGG   Thermus thermophilus HB8: TTHA0233Help
Entry
TTHA0233          CDS       T00220                                 

Definition
(RefSeq) pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00010  Glycolysis / Gluconeogenesis
ttj00020  Citrate cycle (TCA cycle)
ttj00260  Glycine, serine and threonine metabolism
ttj00280  Valine, leucine and isoleucine degradation
ttj00620  Pyruvate metabolism
ttj00630  Glyoxylate and dicarboxylate metabolism
ttj00640  Propanoate metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01200  Carbon metabolism
Module
ttj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA0233
   00020 Citrate cycle (TCA cycle)
    TTHA0233
   00620 Pyruvate metabolism
    TTHA0233
   00630 Glyoxylate and dicarboxylate metabolism
    TTHA0233
   00640 Propanoate metabolism
    TTHA0233
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHA0233
   00280 Valine, leucine and isoleucine degradation
    TTHA0233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ttj04147]
    TTHA0233
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     TTHA0233
Exosome [BR:ttj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TTHA0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like FAD_binding_2 GIDA AlaDh_PNT_C FAD_oxidored NAD_binding_8 FAD_binding_3 Lycopene_cycl K_oxygenase 3HCDH_N XdhC_C NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 3169717
NCBI-ProteinID: YP_143499
UniProt: Q5SLR0
Structure
PDB: 

Position
225850..227244
Genome map
AA seq 464 aa AA seqDB search
MTPMKTYDLIVIGTGPGGYHAAIRAAQLGLKVLAVEAGEVGGVCLNVGCIPTKALLHAAE
TLHHLKVAEGFGLKAKPELDLKKLGGWRDQVVKKLTGGVGTLLKGNGVELLRGFARLVGP
KEVEVGGERYGAKSLILATGSEPLELKGFPFGEDVWDSTRALKVEEGLPKRLLVIGGGAV
GLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEKEGIRVRTKTKAVGYEKKK
DGLHVRLEPAEGGEGEEVVVDKVLVAVGRKPRTEGLGLEKAGVKVDERGFIRVNARMETS
VPGVYAIGDAARPPLLAHKAMREGLIAAENAAGKDSAFDYQVPSVVYTSPEWAGVGLTEE
EAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQAGELIAEA
ALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQAIHILNR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctatgaagacctacgacctcatcgtgatcggcaccggcccggggggctaccac
gccgccatccgggccgcccagctcggcctcaaggtgctggcggtggaggcgggcgaggtg
gggggggtctgcctcaacgtgggctgcatccccaccaaggccctcctccacgccgccgag
accctccaccacctgaaggtggccgaggggttcggcctgaaggccaagccggagctggac
ctgaagaagctcggcggctggcgggatcaggtggtgaaaaagctcaccgggggcgtgggc
accctcctcaaggggaacggggtggagctcctcaggggcttcgcccgcttggtgggcccc
aaggaggtggaggtagggggcgagcgttacggggcaaaaagcctgatcctcgccacgggg
agcgaacccctggagctcaagggcttccccttcggcgaggacgtctgggactccacccgg
gcccttaaggtagaggagggcctccccaagcgcctcctggtcatcggcgggggggcggtg
ggcctcgagctcggccaggtctaccgccgcctgggcgcggaggtcaccctcattgagtac
atgccggagatcctcccccagggcgaccccgagaccgccgccctcctaaggcgcgccctg
gaaaaggaggggataagggttcgcaccaagaccaaggccgtgggctacgagaagaagaag
gacggcctccacgtgcgcctcgagcccgccgagggcggcgagggggaggaggtggtggtg
gacaaggtcctggtggccgtgggccggaagccccgcacggagggcctgggcctggagaag
gccggggtcaaggtggacgagcggggcttcatccgggtgaacgcccggatggagacgagc
gtccccggggtctacgccatcggcgacgcggcccgcccccccctcctcgcccacaaggcc
atgcgggaggggctcatcgccgccgagaacgccgccggcaaggacagcgcctttgactac
caggtcccgagcgtggtctacacctcccccgagtgggccggggtgggcctcaccgaggag
gaagcgaagcgggcgggctacaaggtgaaggtggggaagttccccctcgccgccagtggc
cgggccctcaccctgggcggggccgaggggatggtcaaggtggtgggggacgaggagacg
gacctcctcctcggggtcttcatcgtggggccccaggcgggggagctcatcgccgaggcc
gccttggccctggagatgggggccacgctcaccgacctcgccctcaccgtccacccccac
cccaccctctcggaaagcctcatggaggcggcggaggccttccacaagcaggccatccac
atcctgaaccgctag

DBGET integrated database retrieval system