KEGG   Thermus thermophilus HB8: TTHA0244
Entry
TTHA0244          CDS       T00220                                 
Symbol
TTHA0244
Name
(GenBank) single-stranded DNA binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03030  DNA replication
ttj03430  Mismatch repair
ttj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TTHA0244 (TTHA0244)
   03430 Mismatch repair
    TTHA0244 (TTHA0244)
   03440 Homologous recombination
    TTHA0244 (TTHA0244)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttj03032]
    TTHA0244 (TTHA0244)
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0244 (TTHA0244)
   03029 Mitochondrial biogenesis [BR:ttj03029]
    TTHA0244 (TTHA0244)
DNA replication proteins [BR:ttj03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    TTHA0244 (TTHA0244)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     TTHA0244 (TTHA0244)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    TTHA0244 (TTHA0244)
Mitochondrial biogenesis [BR:ttj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    TTHA0244 (TTHA0244)
SSDB
Motif
Pfam: SSB tRNA_anti-codon
Other DBs
NCBI-ProteinID: BAD70067
UniProt: Q5SLP9
Structure
Position
1:complement(235462..236253)
AA seq 263 aa
MARGLNRVFLIGALATRPDMRYTPAGLAILDLTLAGQDLLLSDNGGEREVSWYHRVRLLG
RQAEMWGDLLDQGQLVFVEGRLEYRQWEREGERRSELQIRADFLDPLDDRGKERAEDSRG
QPRLRAALNQVFLMGNLTRDPELRYTPQGTAVARLGLAVNERRQGAEERTHFVEVQAWRD
LAEWAAELRKGDGLFVIGRLVNDSWTSSSGERRFQTRVEALRLERPTRGPAQAGGSRSRE
VQTGGVDIDEGLEDFPPEEELPF
NT seq 792 nt   +upstreamnt  +downstreamnt
atggctcgaggcctgaaccgcgttttcctaatcggcgccctcgccacccggccggacatg
cgctacactccggcggggctcgccattttggacctgaccctcgccggtcaggacctgctc
ctttccgataacgggggggagcgggaggtgtcctggtaccaccgggtgaggctcttaggc
cgccaggcggagatgtggggcgacctcttggaccaagggcagctcgtcttcgtggagggc
cgcctggagtaccgccagtgggaaagggagggggagaggcggagcgagctccagatccgg
gccgacttcctggaccccctggacgaccgggggaaggagcgggcggaggacagccggggc
cagcccaggctccgcgccgccctgaaccaggtcttcctcatgggcaacctgacccgggac
ccggaactccgctacaccccccagggcaccgcggtggcccggctgggcctggcggtgaac
gagcgccgccagggggcggaggagcgcacccacttcgtggaggttcaggcctggcgcgac
ctggcggagtgggccgccgagctgaggaagggcgacggccttttcgtgatcggcaggttg
gtgaacgactcctggaccagctccagcggcgagcggcgcttccagacccgtgtggaggcc
ctcaggctggagcgccccacccgtggacctgcccaggccggcggaagcaggtcccgcgaa
gtccagacgggtggggtggacattgacgaaggcttggaagactttccgccggaggaggag
ttgccgttttga

DBGET integrated database retrieval system