KEGG   Thermus thermophilus HB8: TTHA0315
Entry
TTHA0315          CDS       T00220                                 
Symbol
TTHA0315
Name
(GenBank) conserved hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: TPR_2 TPR_7 TPR_19 ANAPC3 TPR_4 TPR_14 TPR_12 TPR_6 TPR_16 TPR_17 DUF1839
Other DBs
NCBI-ProteinID: BAD70138
UniProt: Q5SLH8
Position
1:304494..305459
AA seq 321 aa
MLRMILLPSLGPLHILHPRYNAATVLAILEAANPPVVYLASHSEASLAEGTWREEDPLLF
HLLPWAEARGVPVVPVDREAHLKGEAEAFREALAQYPAARPHLERLAAFDRDLSALLQRP
LTPERLYAPEFLGELGALYEGFVRAFGEGPATGFRARRVAGVVEALKGREGAVVADLLDF
LLLLEAFPQEGPPPHRPTEAERVRALLDRAWLLKEEDDWGALVEQLFAIGSPEALYLAAQ
VYLASGQWEDALALMEEVFRMDFQHPGYLPGYVLARMGQLLDLAGERERALRAYRGVLAL
SWAPEEARAVALAGLKTPFRL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgctaaggatgatcctcctgccctccctcggtcccctccacatactccacccacgctac
aacgccgccacggtcctggccatcctcgaggcggccaacccccccgtggtctacctggcc
tcccactccgaggcctccctcgccgagggcacctggcgggaggaggaccccctcctcttc
cacctcctcccctgggcggaggcgcggggcgtgcccgtggtgcccgtggaccgggaggcc
cacctgaagggggaggcggaggccttccgggaggccttggcccagtacccggcggcccgg
ccccacctggagcgcctggccgcctttgaccgggacctctccgccctcctgcaaaggccc
ctcaccccggagcgcctctacgcccccgagttcctgggcgagctcggcgccctctacgag
ggcttcgtccgtgccttcggcgagggcccggccacgggcttccgggccaggcgggtggcg
ggggtggtggaggcgctgaagggccgggagggggccgtggtggcggaccttttggacttc
ctccttctcctcgaggccttcccccaggaaggccccccgccccaccggcccacggaggcg
gagcgcgtccgggcccttttggaccgggcctggctccttaaggaggaggacgactggggc
gcgcttgtggagcagctcttcgccatcggctccccggaggccctgtaccttgcggcccag
gtctacctggcctcggggcagtgggaggacgccctggccctcatggaggaggtcttccgc
atggacttccagcacccaggctacctcccggggtacgtcctggcccggatggggcagctt
ctggacctcgccggggagcgggagcgggccttacgggcctaccggggggtcctggccctc
tcctgggccccggaggaggcgagggccgtggccctggcggggctgaagacgcctttccgc
ctctaa

DBGET integrated database retrieval system