KEGG   Thermus thermophilus HB8: TTHA0329
Entry
TTHA0329          CDS       T00220                                 
Symbol
TTHA0329
Name
(GenBank) DNA-3-methyladenine glycosidase
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TTHA0329 (TTHA0329)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0329 (TTHA0329)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     TTHA0329 (TTHA0329)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     TTHA0329 (TTHA0329)
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-ProteinID: BAD70152
UniProt: Q5SLG4
Position
1:315725..316282
AA seq 185 aa
MFEHPVLAAFYRRHGPAPFAPNPFPQRPPFRVLAESVVAQQLSTRAAARLAERLFRLVPP
TPEAFLEAPLDLLRQAGLSRAKALALKDLAAKAEEGLLDGLDRLEDEAVVERLTRVRGVG
LWTAEMFLMFGLGRPDVWPVRDLGLRRAAARLFGVAPEALPAFGEAFRPYRSHLAWYLWR
SLSSP
NT seq 558 nt   +upstreamnt  +downstreamnt
ttgtttgagcaccccgtcctcgccgccttttaccggcggcacggccccgcccccttcgcc
cccaacccctttccccaaaggccccccttccgcgtgctcgcggagagcgtggtggcccag
cagctctccacccgggcggccgcccgcctcgccgagcgcctcttccgcctcgtccctcct
accccggaggccttcctcgaggcccccttggacctcctgcggcaggcgggcctctcccgg
gccaaggccttggccctgaaagacctcgcggccaaggccgaggaagggcttctggacggg
cttgaccgcctggaggacgaggcggtggtggagcgcctcacccgcgtccggggggtgggg
ctttggaccgcggagatgtttttgatgttcggcctgggaaggcccgacgtctggccggtg
cgggacctggggcttcgccgggccgcggcgcgccttttcggcgtggcccccgaggccctt
cccgccttcggcgaggccttccgcccctaccggagccacctcgcgtggtacctatggcga
agcctgtcctccccctaa

DBGET integrated database retrieval system