KEGG   Thermus thermophilus HB8: TTHA0366
Entry
TTHA0366          CDS       T00220                                 

Gene name
gatB
Definition
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00970  Aminoacyl-tRNA biosynthesis
ttj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTHA0366 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ttj03029]
    TTHA0366 (gatB)
Enzymes [BR:ttj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TTHA0366 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TTHA0366 (gatB)
Mitochondrial biogenesis [BR:ttj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TTHA0366 (gatB)
SSDB
Motif
Pfam: GatB_N GatB_Yqey DMPK_coil
Other DBs
NCBI-GeneID: 3169083
NCBI-ProteinID: YP_143632
UniProt: Q9LCX2
Structure
PDB: 
3KFU

Position
345749..347158
AA seq 469 aa
MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGL
RLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGERRVRIKRLHLE
EDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQALVQTLGISDASP
EEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEILRRGEKVKQAT
MGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARYRA
LGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLS
PEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEALVRERGLKVVADEGALKALVAEAI
AAMPEAAESVRQGKVKALDALVGQVMRKTRGQARPDLVRRLLLEALGVG
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtacgaagccgtcatcggcctcgaggtccacctgcacctcaagacccgcaccaagatg
ttctgcggctgccgggcggactacttcggggcggagcccaacacccacacctgcccggtc
tgcctaggcctcccgggggccctccccgtgcccaaccgggtggcggtggagcacggcctg
aggctcgccctggccttgggggccgaggtgccggaaaggctcgtcttccaccgcaagaac
tacttctaccccgacctccccaagaactaccagatcagccagtacgacctccccttgggc
cgggggggaagcctgcctttgggggagcgaagggtgcgcatcaagcgcctccacctggag
gaagacgcggggaaaagcctccacctggaggggcggaccctcctggacctcaaccgggcg
ggaagccccctcattgagctcgtcaccgagcccgacctcaagacccccgaggaggccagg
ctcttccttcagcgcatccaggccctggtccagaccctggggatctccgacgcctccccc
gaagagggcaagctccgggccgacgtcaacgtctccgtgcggcgggtgggggagcctttg
ggcaccaaggtggagatcaaaaacctcaactccttcaagagcgtgcaacgggccctggag
tacgagatccgccgccagacggagatcctaaggcggggggagaaggtgaagcaggcgacc
atgggctttgaggaggggagcggcaaaacctaccccatgcgcaccaaggaggaagaggcc
gactaccgctacttccccgagcccgacctgccccccgtggccatcccccgggactggctt
gaggaggtgcggcgaagccttcccgagctcccctgggagaaggaggcccgctaccgcgcc
ctaggcatcaaggaaaaggacgccgaggtcctggcctacaccccctccctcgcccgcttc
ctagaccaggcccttcccttgggcctcgcctccccccaggccctggccaactggctcctc
gccgacgtggcggggcttctccacgagcggggcctccgcctggaggagacccggctctcc
cccgagggcctcgcccggctcgtggggctctttgagcggggagaggtcacgagccgggtg
gccaaaagcctcctccccgaggtcctcgagggccaggacccggaggccctggtgcgggaa
cgggggctcaaggtggtggcggacgagggggcgctgaaggccttggtggccgaggccatc
gccgccatgcccgaggcggcggaaagcgtccgccaaggaaaggtcaaggccctggacgcc
ctcgtgggccaggtgatgcgcaagacccggggccaagcccggcccgacctggtgcgccgc
ctcctcctcgaggcccttggggtaggatag

DBGET integrated database retrieval system